BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1390 (383 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A4VY78 Cluster: Putative uncharacterized protein; n=3; ... 32 3.3 UniRef50_Q4Z2R2 Cluster: BIR protein, putative; n=17; Plasmodium... 32 3.3 UniRef50_A2EJ05 Cluster: Putative uncharacterized protein; n=1; ... 31 5.7 >UniRef50_A4VY78 Cluster: Putative uncharacterized protein; n=3; Streptococcus suis|Rep: Putative uncharacterized protein - Streptococcus suis (strain 05ZYH33) Length = 286 Score = 32.3 bits (70), Expect = 3.3 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = -1 Query: 218 MKHLTGAYAIITVFS--LRHKINLKTKTHFKDTSLYTIVILKFFKNS 84 MK LT +++ TVF L IN+K H +DT+ T+++ K N+ Sbjct: 1 MKKLTKLFSVFTVFLTVLGSLINIKHLVHAEDTASTTVIVHKIVMNN 47 >UniRef50_Q4Z2R2 Cluster: BIR protein, putative; n=17; Plasmodium (Vinckeia)|Rep: BIR protein, putative - Plasmodium berghei Length = 238 Score = 32.3 bits (70), Expect = 3.3 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -1 Query: 344 SDKFSLSSHYNKQ-YNQYK*FSIRKIECWCSA*IVTMSKYFIQMKHLTGAY 195 SD + +S NK YN +K F I++ EC+ S I MSK++ K L Y Sbjct: 41 SDNYCSNSLKNKTGYNNFKEF-IKRNECFMSINITDMSKFYGAFKSLCNMY 90 >UniRef50_A2EJ05 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 531 Score = 31.5 bits (68), Expect = 5.7 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -3 Query: 279 PKNRMLVFRMNRDYVKIFHPNETFDWGL 196 PK +M V+R++ +Y +FH E+F GL Sbjct: 181 PKAKMAVYRLSDEYYTLFHDEESFREGL 208 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 320,666,748 Number of Sequences: 1657284 Number of extensions: 5554579 Number of successful extensions: 11245 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10976 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11230 length of database: 575,637,011 effective HSP length: 91 effective length of database: 424,824,167 effective search space used: 15293670012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -