BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1390 (383 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0581 + 4310136-4310186,4310940-4311144,4311245-4311410,431... 28 2.2 01_01_0690 - 5306754-5307047,5307107-5307279,5308223-5308370,530... 27 5.1 >03_01_0581 + 4310136-4310186,4310940-4311144,4311245-4311410, 4312035-4312257,4312891-4312967,4313091-4313278, 4313363-4313457,4313674-4313807,4313914-4314024, 4314304-4314619,4314919-4315040,4315183-4315293, 4315824-4316012,4316105-4316263,4316449-4316530, 4317080-4317190 Length = 779 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -1 Query: 206 TGAYAIITVFSLRHKINLKTKTHFKDTSLYTIVILKFFKNSKLTI 72 TG T+F ++ + H K+T+ +I FFK SKL++ Sbjct: 176 TGQVVYETMFVWNEFLSRAIRNHLKNTTWTVALIHGFFKQSKLSV 220 >01_01_0690 - 5306754-5307047,5307107-5307279,5308223-5308370, 5309110-5309356,5309694-5309839,5312482-5312707, 5313652-5313874,5314054-5314202,5315345-5315514, 5316064-5316135,5317610-5317741,5317813-5317900, 5319440-5319656,5320123-5320306,5320644-5320727, 5321148-5321242,5321519-5321562,5321707-5322367, 5323053-5323356 Length = 1218 Score = 27.1 bits (57), Expect = 5.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 40 FYKCVNTWQAVIVSLEFLKNFKMT 111 FY N AV+ SL+ L+NF+ T Sbjct: 1190 FYTVKNEGNAVVCSLQLLRNFRFT 1213 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,004,754 Number of Sequences: 37544 Number of extensions: 129781 Number of successful extensions: 228 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 224 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 228 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 636799876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -