BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1384 (728 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n... 68 3e-10 UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep: ... 48 2e-04 UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY0513... 44 0.004 UniRef50_UPI0000F2EBCE Cluster: PREDICTED: hypothetical protein;... 40 0.062 UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 40 0.062 UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; ... 38 0.33 UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus lu... 36 1.3 UniRef50_A5LFU4 Cluster: Putative uncharacterized protein; n=2; ... 34 3.1 UniRef50_A7RZL6 Cluster: Predicted protein; n=1; Nematostella ve... 33 9.5 >UniRef50_UPI0000ECD483 Cluster: UPI0000ECD483 related cluster; n=1; Gallus gallus|Rep: UPI0000ECD483 UniRef100 entry - Gallus gallus Length = 103 Score = 67.7 bits (158), Expect = 3e-10 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = +3 Query: 510 AAAGTRLALQLFLVKIFKVYSFRLRGLVRVPYRYFSSLPPRAGSG 644 AAAGTRLALQ LVK FKV SF+L+GL RV Y YFSSLPPR GSG Sbjct: 59 AAAGTRLALQWILVKGFKVDSFQLQGLERVLYCYFSSLPPRVGSG 103 >UniRef50_Q6QI94 Cluster: LRRG00114; n=1; Rattus norvegicus|Rep: LRRG00114 - Rattus norvegicus (Rat) Length = 223 Score = 48.0 bits (109), Expect = 2e-04 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = +3 Query: 657 LLPSLDVVAVSQAPSPESNPDSP 725 LLPSLDVVAVSQAPSPE NPDSP Sbjct: 167 LLPSLDVVAVSQAPSPELNPDSP 189 >UniRef50_Q7RED5 Cluster: Putative uncharacterized protein PY05130; n=6; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY05130 - Plasmodium yoelii yoelii Length = 402 Score = 44.0 bits (99), Expect = 0.004 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = +3 Query: 84 GKCFR*CSSCDDPRISPLTSQYECPQ 161 GKCFR C S ++ RISPLTS+Y+CPQ Sbjct: 259 GKCFRSCLSPENLRISPLTSEYKCPQ 284 Score = 43.2 bits (97), Expect = 0.007 Identities = 26/54 (48%), Positives = 29/54 (53%) Frame = +1 Query: 466 LTATILVYAIGAGITRLLAPDLPSNCSSLKYLKCTHSDYEAS*ESRIVIFRHYL 627 LTATIL+YAIGAGIT L K L HS+Y+ IVI HYL Sbjct: 314 LTATILIYAIGAGITAAAGTRLALQLIFGKVLSSHHSNYKTKIWPYIVISCHYL 367 >UniRef50_UPI0000F2EBCE Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 493 Score = 39.9 bits (89), Expect = 0.062 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 587 PRKSPVSLFFVTTSPCREW 643 PRKSPV LFFVTTSP REW Sbjct: 24 PRKSPVLLFFVTTSPGREW 42 >UniRef50_A7SUZ6 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Nematostella vectensis Length = 79 Score = 39.9 bits (89), Expect = 0.062 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = -3 Query: 75 FHQSRTKVRGSKAIRYRPSSNRK 7 F RTKVRGSK IRYRPSSN K Sbjct: 6 FRCQRTKVRGSKTIRYRPSSNHK 28 >UniRef50_A2GSA9 Cluster: Putative uncharacterized protein; n=3; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 76 Score = 37.5 bits (83), Expect = 0.33 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = +3 Query: 624 PPRAGSG*FARLLPSLDVVAVSQAPSP 704 PP+ SG +RLL +D+VA+SQAPSP Sbjct: 46 PPKVSSGKVSRLLLPVDIVAISQAPSP 72 >UniRef50_A4S1P1 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 72 Score = 35.5 bits (78), Expect = 1.3 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -3 Query: 75 FHQSRTKVRGSKAIRYRPSSNRK 7 FH RTKV GSK IRY PS N K Sbjct: 6 FHCQRTKVGGSKMIRYHPSLNHK 28 >UniRef50_A5LFU4 Cluster: Putative uncharacterized protein; n=2; Streptococcus pneumoniae|Rep: Putative uncharacterized protein - Streptococcus pneumoniae SP3-BS71 Length = 81 Score = 34.3 bits (75), Expect = 3.1 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -1 Query: 518 SSRVIPAPIAYTKIVAVKKL 459 ++ VIPAPIAY K+VAVKKL Sbjct: 3 AAAVIPAPIAYIKVVAVKKL 22 >UniRef50_A7RZL6 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 73 Score = 32.7 bits (71), Expect = 9.5 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -1 Query: 518 SSRVIPAPIAYTKIVAVKK 462 ++ VIPAPIAY K+VAVKK Sbjct: 43 AAAVIPAPIAYIKVVAVKK 61 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 726,364,953 Number of Sequences: 1657284 Number of extensions: 15018440 Number of successful extensions: 36779 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 35596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36768 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 58853922985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -