BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1384 (728 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 23 3.3 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 3.3 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 5.8 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 21 7.7 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 22.6 bits (46), Expect = 3.3 Identities = 12/40 (30%), Positives = 15/40 (37%) Frame = +3 Query: 408 SITADACTDSAAHKCNYELFNRNNFSIRYWSWNYAAAGTR 527 ++ ADA + K E F NF W Y G R Sbjct: 111 AVAADATKRATMAKSALEFFETYNFDGLDVDWEYPLEGDR 150 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 22.6 bits (46), Expect = 3.3 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +1 Query: 469 TATILVYAIGAGITRLLAPDLPSNCSSLKYLKCTHSDYEA 588 T +L ++ +A ++ N SSL+YL ++D A Sbjct: 465 TPNLLSLSLAFNSLPTVALEVAGNISSLRYLNLDYNDLSA 504 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = -3 Query: 291 LNKLECSKRAKNVLEYFVHGIIEYDLGSI 205 L+ L+ ++ KN+LE + Y+LG + Sbjct: 387 LSLLQVAQIFKNLLENHYEEFVRYELGEL 415 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 278 SAQSGLKMCLNIS 240 S+Q G K CLN+S Sbjct: 32 SSQKGQKTCLNLS 44 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,353 Number of Sequences: 336 Number of extensions: 3689 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -