BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1384 (728 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY122081-1|AAM52593.1| 341|Drosophila melanogaster AT23411p pro... 29 6.5 AE014296-2892|AAF49353.2| 1324|Drosophila melanogaster CG7692-PA... 29 6.5 AE014297-3736|AAF56416.3| 993|Drosophila melanogaster CG13654-P... 29 8.6 >AY122081-1|AAM52593.1| 341|Drosophila melanogaster AT23411p protein. Length = 341 Score = 29.1 bits (62), Expect = 6.5 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -1 Query: 725 RGIRVRFRRGSLRNGYHIQGRQQARKLPTPGTGR 624 RG+RVR +R ++ N Y+ Q R+ R+L G+ Sbjct: 162 RGVRVRVKRTNMANFYNDQTRRSQRRLTASLNGQ 195 >AE014296-2892|AAF49353.2| 1324|Drosophila melanogaster CG7692-PA protein. Length = 1324 Score = 29.1 bits (62), Expect = 6.5 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -1 Query: 725 RGIRVRFRRGSLRNGYHIQGRQQARKLPTPGTGR 624 RG+RVR +R ++ N Y+ Q R+ R+L G+ Sbjct: 1145 RGVRVRVKRTNMANFYNDQTRRSQRRLTASLNGQ 1178 >AE014297-3736|AAF56416.3| 993|Drosophila melanogaster CG13654-PA protein. Length = 993 Score = 28.7 bits (61), Expect = 8.6 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = -2 Query: 655 RAN-YPLPARGGSDEK*RYGTLTRPRNRNEYTLNI-LTRNNWRASLV 521 RAN YPL GG+D +GT+ RP E ++ + N+W +L+ Sbjct: 352 RANGYPL---GGTDHNHGHGTIIRPNQTTEISIQFGVQPNSWHYALL 395 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,867,405 Number of Sequences: 53049 Number of extensions: 712436 Number of successful extensions: 1733 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1733 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3273062859 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -