BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1384 (728 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 2.2 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 23 2.9 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 23 2.9 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 2.9 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 2.9 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 3.9 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 3.9 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 3.9 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 22 5.2 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 5.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.2 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 9.0 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 9.0 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 9.0 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 9.0 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 9.0 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 9.0 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 23.4 bits (48), Expect = 2.2 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +3 Query: 501 WNYAAAGTRLALQLFLVKIFKVYSFRLRGLVRVPYRY 611 WN A LA+ LFL + V+ L L V RY Sbjct: 39 WNLATDRAGLAILLFLFSVATVFGNTLVILAVVRERY 75 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 453 NYELFNRNNFSIRYWSWNY 509 NY +N++N++ Y++ NY Sbjct: 97 NYNNYNKHNYNKLYYNINY 115 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 453 NYELFNRNNFSIRYWSWNY 509 NY +N++N++ Y++ NY Sbjct: 97 NYNNYNKHNYNKLYYNINY 115 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 453 NYELFNRNNFSIRYWSWNY 509 NY +N++N++ Y++ NY Sbjct: 97 NYNNYNKHNYNKLYYNINY 115 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 453 NYELFNRNNFSIRYWSWNY 509 NY +N++N++ Y++ NY Sbjct: 97 NYNNYNKHNYNKLYYNINY 115 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 453 NYELFNRNNFSIRYWSWNY 509 NY +N++N++ Y++ NY Sbjct: 97 NYNNYNKHNYNKLYYNINY 115 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 453 NYELFNRNNFSIRYWSWNY 509 NY +N++N++ Y++ NY Sbjct: 97 NYNNYNKHNYNKLYYNINY 115 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 453 NYELFNRNNFSIRYWSWNY 509 NY +N++N++ Y++ NY Sbjct: 97 NYNNYNKHNYNKLYYNINY 115 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 453 NYELFNRNNFSIRYWSWNY 509 NY +N++N++ Y++ NY Sbjct: 97 NYNNYNKHNYNKLYYNINY 115 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 453 NYELFNRNNFSIRYWSWNY 509 NY +N++N++ Y++ NY Sbjct: 97 NYNNYNKHNYNKLYYNINY 115 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 453 NYELFNRNNFSIRYWSWNY 509 NY +N++N++ Y++ NY Sbjct: 330 NYNNYNKHNYNKLYYNINY 348 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 2.9 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 453 NYELFNRNNFSIRYWSWNY 509 NY +N++N++ Y++ NY Sbjct: 330 NYNNYNKHNYNKLYYNINY 348 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.9 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = +2 Query: 140 VAIRMPPVIPINH-----YLGVLKTN 202 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.9 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = +2 Query: 140 VAIRMPPVIPINH-----YLGVLKTN 202 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.9 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = +2 Query: 140 VAIRMPPVIPINH-----YLGVLKTN 202 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 22.2 bits (45), Expect = 5.2 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -1 Query: 128 NSWIVARRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 6 N +VAR A F V IN+ + R+ L+ T+N Sbjct: 351 NQAVVARHDEAMIFPADVKINRGLXWIISDRMPVFLLXTLN 391 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 5.2 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 117 RRKTNISESICQRCFHQ 67 RR+ N++E++C F Q Sbjct: 966 RRRLNVNETVCSDYFSQ 982 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 673 SKEGSRRANYPLPARGGSDEK*RYG 599 +K S+ AN P PA GG + + G Sbjct: 1014 AKPQSQEANKPKPATGGKGTRPKRG 1038 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +3 Query: 435 SAAHKCNYELFNRNNFSIRYWSWNY 509 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +3 Query: 435 SAAHKCNYELFNRNNFSIRYWSWNY 509 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +3 Query: 435 SAAHKCNYELFNRNNFSIRYWSWNY 509 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +3 Query: 435 SAAHKCNYELFNRNNFSIRYWSWNY 509 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +3 Query: 435 SAAHKCNYELFNRNNFSIRYWSWNY 509 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.4 bits (43), Expect = 9.0 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 339 YRGALR*VSRWADNFTLNKLECSKRAKNVLE 247 Y G LR S + ++ N E + KNVL+ Sbjct: 424 YAGLLRNRSEYLNHLRANVAEGRNQRKNVLD 454 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,349 Number of Sequences: 438 Number of extensions: 4933 Number of successful extensions: 28 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -