BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1381 (661 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7RTF4 Cluster: Putative uncharacterized protein PY0004... 34 3.5 UniRef50_Q23863 Cluster: Histidine kinase A; n=2; Dictyostelium ... 34 3.5 >UniRef50_Q7RTF4 Cluster: Putative uncharacterized protein PY00040; n=9; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY00040 - Plasmodium yoelii yoelii Length = 5229 Score = 33.9 bits (74), Expect = 3.5 Identities = 27/104 (25%), Positives = 43/104 (41%) Frame = +1 Query: 205 LDSTEKSHLERLNVNMYLCLRVKK*VKERAQEFGRSNCSTINFNYNLL*SNFRKGCDTYT 384 L + + + LN N YL + K+ + N + N N N+ + F T Sbjct: 372 LYKNDNTFKDNLNRNNYLQIIEKEIYNNQLYIIANENYKSANLNINVKNTRFTLHNKTIM 431 Query: 385 NLILYL*TSNSCILIYMYII*ISETAPTIFIKFSIQGISGAKID 516 NLI Y S I ++Y+ I P ++I I+ SG +D Sbjct: 432 NLINYFTEMISSIFSFLYVYII---YPEVYISDLIEIASGINVD 472 >UniRef50_Q23863 Cluster: Histidine kinase A; n=2; Dictyostelium discoideum|Rep: Histidine kinase A - Dictyostelium discoideum (Slime mold) Length = 2150 Score = 33.9 bits (74), Expect = 3.5 Identities = 23/59 (38%), Positives = 32/59 (54%) Frame = -1 Query: 322 LNNYFFQIPVLSP*LIS*HVNINTYSHLNVLNVIFR*NPK*VSSNFNN*WSPVNLNSPI 146 LNN +P LSP I+ H+N++ ++ N N+ NP S+N NN SP N N I Sbjct: 389 LNNNSSNLPPLSPRHINFHINVSNLNNNNNNNINPNNNPN-NSNNSNNNVSPRNNNHNI 446 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 555,537,687 Number of Sequences: 1657284 Number of extensions: 10380069 Number of successful extensions: 17217 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17209 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 50000004659 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -