BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1381 (661 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1296.03c |sxa2||serine carboxypeptidase Sxa2|Schizosaccharom... 27 3.2 SPBC1306.02 ||SPBC4.08|WD repeat protein, human WDR6 family|Schi... 26 4.2 >SPAC1296.03c |sxa2||serine carboxypeptidase Sxa2|Schizosaccharomyces pombe|chr 1|||Manual Length = 507 Score = 26.6 bits (56), Expect = 3.2 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +1 Query: 355 NFRKGCDTYT--NLILYL*TSNSCILIY 432 N GCD Y+ N +LYL NSC++ Y Sbjct: 323 NSISGCDLYSLSNFLLYL--ENSCVITY 348 >SPBC1306.02 ||SPBC4.08|WD repeat protein, human WDR6 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 984 Score = 26.2 bits (55), Expect = 4.2 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +2 Query: 500 RGRKSI*LRFIFRKCCFIRVFNNQFFPTSMSNNNTIFLN*GQLTALKKQQD 652 +G+K+I IR + N FF + SN TI++ Q T L K D Sbjct: 357 KGKKAIPALTTTSDMSIIRSWKNSFFVAAASNKGTIYVFSYQNTNLLKAID 407 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,470,915 Number of Sequences: 5004 Number of extensions: 48323 Number of successful extensions: 79 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 79 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -