BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1377 (741 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z30662-10|CAI58651.1| 409|Caenorhabditis elegans Hypothetical p... 28 8.0 Z30662-9|CAA83138.2| 451|Caenorhabditis elegans Hypothetical pr... 28 8.0 >Z30662-10|CAI58651.1| 409|Caenorhabditis elegans Hypothetical protein T16H12.5b protein. Length = 409 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 4/52 (7%) Frame = +1 Query: 229 PWPPSCCHDDQRL----SWCPMSVF*AP*HYVWFIPQRQFCLPKLAHLAPSS 372 P P S H D L +WC V +Y+W I FC ++ + SS Sbjct: 26 PSPSSASHGDPLLPVAENWCHTQVKVVKFNYMWTINNFSFCREEMGEVLKSS 77 >Z30662-9|CAA83138.2| 451|Caenorhabditis elegans Hypothetical protein T16H12.5a protein. Length = 451 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 4/52 (7%) Frame = +1 Query: 229 PWPPSCCHDDQRL----SWCPMSVF*AP*HYVWFIPQRQFCLPKLAHLAPSS 372 P P S H D L +WC V +Y+W I FC ++ + SS Sbjct: 68 PSPSSASHGDPLLPVAENWCHTQVKVVKFNYMWTINNFSFCREEMGEVLKSS 119 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,195,053 Number of Sequences: 27780 Number of extensions: 407806 Number of successful extensions: 860 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 829 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 860 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1745954468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -