BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1376 (697 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76965.1 68414.m08961 glycine-rich protein 30 1.3 At5g56500.1 68418.m07051 chaperonin, putative similar to SWISS-P... 29 3.9 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 3.9 At5g42370.1 68418.m05159 expressed protein 29 3.9 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 29 3.9 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 29 3.9 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 5.1 At4g21520.1 68417.m03110 transducin family protein / WD-40 repea... 28 6.8 At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-conta... 27 9.0 At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-conta... 27 9.0 At5g22390.1 68418.m02612 expressed protein 27 9.0 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 27 9.0 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 447 PGTGXIRFPSKPDTPRSSEPILIPKLRIQFAD 352 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At5g56500.1 68418.m07051 chaperonin, putative similar to SWISS-PROT:P08927- RuBisCO subunit binding-protein beta subunit, chloroplast precursor (60 kDa chaperonin beta subunit, CPN-60 beta) [Pisum sativum]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 597 Score = 28.7 bits (61), Expect = 3.9 Identities = 22/77 (28%), Positives = 35/77 (45%) Frame = -1 Query: 235 SAESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAASSGHFGLPRRTLVFK 56 S S PP R SS + S F T+++ Q++ FP + AA HF T + K Sbjct: 10 SMGSSLAPPSNRLSSFVS--ISSSSFGRTQSIAQRKARFPKIYAAKQLHFN-KDGTAIKK 66 Query: 55 VEGTIIETVPLPGSGIG 5 ++ + + L G +G Sbjct: 67 LQAGVNKLADLVGVTLG 83 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -2 Query: 234 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 100 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 173 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 63 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -2 Query: 456 STRPGTGXIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 337 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -2 Query: 456 STRPGTGXIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 337 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 229 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 131 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At4g21520.1 68417.m03110 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); similar to guanine nucleotide-binding protein beta 5 (GI:1001939) [Mesocricetus auratus] Length = 425 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 210 GGVRILSADLENSGEDVRGDVAPVRTH 290 GG+++ S + ++S +R DV+P RTH Sbjct: 12 GGLKVESGEQKSSWPTMRFDVSPYRTH 38 >At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 487 NSLKRT*RTNIDQTRHRXHPLPVQTRHAPVLRANPYSEVTDP 362 N K T TN T R +P P Q + P + NP ++ T+P Sbjct: 150 NFAKTTFTTNARTTTPRNNP-PAQKTNPPAQKTNPPAQKTNP 190 >At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 487 NSLKRT*RTNIDQTRHRXHPLPVQTRHAPVLRANPYSEVTDP 362 N K T TN T R +P P Q + P + NP ++ T+P Sbjct: 150 NFAKTTFTTNARTTTPRNNP-PAQKTNPPAQKTNPPAQKTNP 190 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 9.0 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 108 ERSGKSFLFCLSVRVPWNPIEG 173 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +3 Query: 36 SIIVPSTLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 167 S++ +L TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,866,319 Number of Sequences: 28952 Number of extensions: 344536 Number of successful extensions: 1043 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1013 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1043 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -