BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1371 (778 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48014| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 3e-21 SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) 70 2e-12 SB_43122| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) 67 2e-11 SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_4144| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_54081| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_25093| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 7e-11 SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 9e-11 SB_21239| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 9e-11 SB_54118| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_39827| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) 64 1e-10 SB_29785| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_21728| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_17415| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_58570| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_42287| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_42013| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.8) 64 1e-10 SB_37587| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_32512| Best HMM Match : Chlam_OMP3 (HMM E-Value=4.2) 64 1e-10 SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_14423| Best HMM Match : Attractin (HMM E-Value=7) 64 1e-10 SB_11855| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_8557| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_30555| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_26172| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_6437| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_6254| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 64 2e-10 SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_38049| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_34847| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_19329| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_18891| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_17342| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_16538| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_11715| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_9762| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_9131| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_7799| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_3610| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_2425| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_12651| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_36156| Best HMM Match : Attractin (HMM E-Value=7) 63 3e-10 SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4) 63 3e-10 SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_22702| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6) 63 3e-10 SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 63 3e-10 SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_15852| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_15554| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_15246| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_15191| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 63 3e-10 SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_14809| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_14557| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_14002| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_13810| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_13414| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_13136| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_12827| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_12818| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_12237| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_11454| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_10545| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_10392| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_10152| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_10074| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_9728| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_9516| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_9338| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_9120| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_8797| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_8779| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_8654| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_8464| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_8430| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_8410| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_8220| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_7764| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_7356| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_7252| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_7157| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_7113| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_7085| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_6890| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_6616| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_6037| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_5934| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_5529| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_5295| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_5042| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_4511| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_4433| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_4372| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_4226| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_4161| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_3964| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_3933| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_2782| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_2639| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_2564| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_2174| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_2150| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_1538| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_1504| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_1281| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_1196| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_788| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_721| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_548| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_59785| Best HMM Match : TBCA (HMM E-Value=3) 63 3e-10 SB_59546| Best HMM Match : Collagen (HMM E-Value=0.003) 63 3e-10 SB_59242| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_59187| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_59131| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_59001| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_58964| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_58933| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_58264| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_57917| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_57878| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_57788| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_56857| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_56810| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_56195| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_56111| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_55984| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_55672| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_55664| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_55372| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_55221| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_54670| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_54625| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_54192| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_53956| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_53637| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_53434| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_53249| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_52930| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_52839| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_52708| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_52332| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_52026| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_51920| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_51767| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_51579| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_51510| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_51154| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_50997| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_50427| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_50404| Best HMM Match : Pep_M12B_propep (HMM E-Value=6) 63 3e-10 SB_50393| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_50189| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_49781| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_49101| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_49042| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_48963| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_48957| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_48813| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_48453| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_48226| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_47917| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_47720| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_47666| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_47427| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_47350| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_46769| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_46630| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_46329| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_46320| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_46081| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_45450| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_45197| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_45018| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_44709| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_44370| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.9) 63 3e-10 SB_44174| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_44053| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_43619| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_43572| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_42784| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_41701| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_41333| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_41310| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_41098| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_40781| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_40467| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_40329| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_40150| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_40121| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_40085| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_39869| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_39718| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_39341| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_38278| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_37993| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_37765| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_37658| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_37564| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_37287| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_37073| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_36965| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_36882| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_36869| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_36786| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_36725| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_36717| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_36657| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_36525| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_36394| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_36031| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_35815| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_35712| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_35515| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_35475| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_35434| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_35346| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_35321| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_34616| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_34440| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_34397| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_34379| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_34378| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_34023| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_33989| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_33474| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_33416| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_33328| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_32361| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_32275| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_32095| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_32014| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_31990| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_31973| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_31926| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_31716| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_31547| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_31521| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_30243| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_30141| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_29531| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_29169| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_28227| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_28224| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_27489| Best HMM Match : Pep_M12B_propep (HMM E-Value=4.7) 63 3e-10 SB_26909| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_26861| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_26658| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_25285| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_25254| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_25043| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_24889| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_24879| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_24857| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_24789| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_24551| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_24500| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_24211| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_23617| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_23470| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_23311| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_23121| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_22358| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_22112| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_21849| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_21590| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_21571| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_21260| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_21251| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_21222| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_21067| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_20387| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_20159| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_20100| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_20045| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_19308| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_18930| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4) 63 3e-10 SB_18839| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_18500| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_18174| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_18144| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_17469| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_17400| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_17304| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_16489| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_16392| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_16216| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_15984| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_15494| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_15309| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_15056| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4) 63 3e-10 SB_14630| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_14484| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_14392| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_14211| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_13866| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 >SB_48014| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 99.1 bits (236), Expect = 3e-21 Identities = 61/111 (54%), Positives = 69/111 (62%), Gaps = 3/111 (2%) Frame = +3 Query: 435 GEQSNAWRILLRNDRKSRHRRIKKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV- 611 GEQSN WRILLRNDRKSRHRRIKK +AWLPQASYPCGNFS TS KL LK + +V Sbjct: 2 GEQSNTWRILLRNDRKSRHRRIKKQRRYDAWLPQASYPCGNFSDTSSLKL--LKTKGSVG 59 Query: 612 LSQSLCV--LNIWIKPAFAFCSTRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 + ++C+ N + F L LRY LTDVPPQ NS P Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +2 Query: 500 QKARRYERLAATSQXXXXXXXXXXXXXXXYTKGSIGRAFAVPMRTEHLDQASF 658 +K RRY+ + TKGS+G AF V + TE+ +Q SF Sbjct: 24 KKQRRYDAWLPQASYPCGNFSDTSSLKLLKTKGSVGHAFTVCIHTENQNQVSF 76 >SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) Length = 321 Score = 70.1 bits (164), Expect = 2e-12 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = +3 Query: 432 MGEQSNAWRILLRNDRKSRHRRIKKHVAMNAWLPQASYPC 551 +GEQSN WRILLRNDRKS K +VAMNAWLPQASYPC Sbjct: 97 VGEQSNTWRILLRNDRKSDIEGSKSNVAMNAWLPQASYPC 136 >SB_43122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 68.1 bits (159), Expect = 7e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 496 LRCRLFLSLRSKIRQALDCSPIKRERELGLDRRET 392 LRCRLFLSLRS+IRQ LDCSP RERELGLDRRET Sbjct: 15 LRCRLFLSLRSRIRQVLDCSPTNRERELGLDRRET 49 >SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) Length = 149 Score = 66.9 bits (156), Expect = 2e-11 Identities = 44/90 (48%), Positives = 53/90 (58%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 68 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NSPPG Sbjct: 69 HEISVLIELTLGHLRYRLTDVPPQPNSPPG 98 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSF 63 >SB_30858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 66.1 bits (154), Expect = 3e-11 Identities = 42/95 (44%), Positives = 48/95 (50%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 P T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFPVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 60.5 bits (140), Expect = 1e-09 Identities = 42/89 (47%), Positives = 50/89 (56%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + +C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFPVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFPVCIHTENQNQVSF 76 >SB_4144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 65.3 bits (152), Expect = 5e-11 Identities = 43/89 (48%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCVL--NIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + FC Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFCL 68 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 69 HEISVLIELTLGHLRYRLTDVPPQPNSQP 97 >SB_54081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 64.9 bits (151), Expect = 7e-11 Identities = 42/95 (44%), Positives = 48/95 (50%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF RE+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLREISVLIELTLGH 94 Score = 61.7 bits (143), Expect = 6e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 REISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_25093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 64.9 bits (151), Expect = 7e-11 Identities = 44/92 (47%), Positives = 53/92 (57%), Gaps = 3/92 (3%) Frame = +3 Query: 495 RIKKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAF 665 R K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 22 RSKSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPF 79 Query: 666 CSTRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 80 VLHEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 59.7 bits (138), Expect = 3e-09 Identities = 40/95 (42%), Positives = 46/95 (48%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIE SKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIERSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 64.5 bits (150), Expect = 9e-11 Identities = 43/89 (48%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NSPP Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSPP 110 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_21239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 64.5 bits (150), Expect = 9e-11 Identities = 43/98 (43%), Positives = 46/98 (46%), Gaps = 5/98 (5%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTF-----LAPLAKNSLY*R 597 WVNNPTLGEFCFAMIGRADIEGSKS + P F L L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGH 60 Query: 598 IDRPCFRSPYAY*TSGSSQLLPFAPREVSVLAELALGH 711 C + Y S PF E+SVL EL LGH Sbjct: 61 AFTVCIHTENQYQVS----FYPFVLHEISVLIELTLGH 94 Score = 63.7 bits (148), Expect = 2e-10 Identities = 42/89 (47%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQYQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQYQVSF 76 >SB_54118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 64.1 bits (149), Expect = 1e-10 Identities = 43/89 (48%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 LR LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLRHLRYRLTDVPPQPNSQP 110 Score = 59.7 bits (138), Expect = 3e-09 Identities = 40/95 (42%), Positives = 46/95 (48%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL L H Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLRH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 64.1 bits (149), Expect = 1e-10 Identities = 44/90 (48%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + +V + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSVGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 63.3 bits (147), Expect = 2e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSVG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGS+G AF V + TE+ +Q SF Sbjct: 54 TKGSVGHAFTVCIHTENQNQVSF 76 >SB_39827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 64.1 bits (149), Expect = 1e-10 Identities = 43/89 (48%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 LR LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLRHLRYRLTDVPPQPNSQP 110 Score = 59.7 bits (138), Expect = 3e-09 Identities = 40/95 (42%), Positives = 46/95 (48%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL L H Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLRH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 64.1 bits (149), Expect = 1e-10 Identities = 44/90 (48%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + +V + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSVGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 63.3 bits (147), Expect = 2e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSVG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGS+G AF V + TE+ +Q SF Sbjct: 54 TKGSVGHAFTVCIHTENQNQVSF 76 >SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 64.1 bits (149), Expect = 1e-10 Identities = 44/95 (46%), Positives = 54/95 (56%), Gaps = 3/95 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPGMSSNR 776 L LRY LTDVPPQ NS PG +R Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPGSVFDR 116 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) Length = 471 Score = 64.1 bits (149), Expect = 1e-10 Identities = 43/89 (48%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 371 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENHNQVSFYPFVL 428 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 LR LRY LTDVPPQ NS P Sbjct: 429 HEISVLIELTLRHLRYRLTDVPPQPNSQP 457 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKS 63 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 348 WVNNPTLGEFCFAMIGRADIEGSKS 372 Score = 53.2 bits (122), Expect = 2e-07 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILK 596 K +VAMNAWLPQASYPCGNFS TS KL K Sbjct: 62 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTK 93 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 401 TKGSIGHAFTVCIHTENHNQVSF 423 >SB_29785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 64.1 bits (149), Expect = 1e-10 Identities = 43/89 (48%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 LR LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLRHLRYRLTDVPPQPNSQP 110 Score = 59.7 bits (138), Expect = 3e-09 Identities = 40/95 (42%), Positives = 46/95 (48%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL L H Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLRH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_21728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 64.1 bits (149), Expect = 1e-10 Identities = 43/89 (48%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 LR LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLRHLRYRLTDVPPQPNSQP 110 Score = 59.7 bits (138), Expect = 3e-09 Identities = 40/95 (42%), Positives = 46/95 (48%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL L H Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLRH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_17415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 64.1 bits (149), Expect = 1e-10 Identities = 43/89 (48%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 LR LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLRHLRYRLTDVPPQPNSQP 110 Score = 59.7 bits (138), Expect = 3e-09 Identities = 40/95 (42%), Positives = 46/95 (48%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL L H Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLRH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_58570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 64.1 bits (149), Expect = 1e-10 Identities = 43/89 (48%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENHNQVSFYPFVL 68 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 LR LRY LTDVPPQ NS P Sbjct: 69 HEISVLIELTLRHLRYRLTDVPPQPNSQP 97 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 41 TKGSIGHAFTVCIHTENHNQVSF 63 >SB_42287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 64.1 bits (149), Expect = 1e-10 Identities = 43/89 (48%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENHNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 LR LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLRHLRYRLTDVPPQPNSQP 110 Score = 59.3 bits (137), Expect = 3e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKS 507 WVNNPTLGEFCFAMIGRADIEGSKS Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKS 25 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENHNQVSF 76 >SB_42013| Best HMM Match : Pep_M12B_propep (HMM E-Value=3.8) Length = 128 Score = 64.1 bits (149), Expect = 1e-10 Identities = 43/89 (48%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 LR LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLRHLRYRLTDVPPQPNSQP 110 Score = 59.7 bits (138), Expect = 3e-09 Identities = 40/95 (42%), Positives = 46/95 (48%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL L H Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLRH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_37587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 64.1 bits (149), Expect = 1e-10 Identities = 43/89 (48%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 LR LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLRHLRYRLTDVPPQPNSQP 110 Score = 59.7 bits (138), Expect = 3e-09 Identities = 40/95 (42%), Positives = 46/95 (48%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL L H Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLRH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_32512| Best HMM Match : Chlam_OMP3 (HMM E-Value=4.2) Length = 175 Score = 64.1 bits (149), Expect = 1e-10 Identities = 43/89 (48%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 75 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 132 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 LR LRY LTDVPPQ NS P Sbjct: 133 HEISVLIELTLRHLRYRLTDVPPQPNSQP 161 Score = 59.7 bits (138), Expect = 3e-09 Identities = 40/95 (42%), Positives = 46/95 (48%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 52 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 110 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL L H Sbjct: 111 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLRH 145 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 105 TKGSIGHAFTVCIHTENQNQVSF 127 >SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 64.1 bits (149), Expect = 1e-10 Identities = 44/90 (48%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + +V + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSVGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 63.3 bits (147), Expect = 2e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSVG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGS+G AF V + TE+ +Q SF Sbjct: 54 TKGSVGHAFTVCIHTENQNQVSF 76 >SB_14423| Best HMM Match : Attractin (HMM E-Value=7) Length = 162 Score = 64.1 bits (149), Expect = 1e-10 Identities = 44/90 (48%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + +V + ++C+ N + F Sbjct: 62 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSVGHAFTVCIHAENQNQVSFYPFVL 119 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 120 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 149 Score = 62.5 bits (145), Expect = 4e-10 Identities = 40/94 (42%), Positives = 44/94 (46%), Gaps = 1/94 (1%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RP 609 WVNNPTLGEFCFAMIGRADIEGSKS + P F + L + Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSVGH 98 Query: 610 CFRSPYAY*TSGSSQLLPFAPREVSVLAELALGH 711 F PF E+SVL EL LGH Sbjct: 99 AFTVCIHAENQNQVSFYPFVLHEISVLIELTLGH 132 Score = 28.7 bits (61), Expect = 5.5 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGS+G AF V + E+ +Q SF Sbjct: 92 TKGSVGHAFTVCIHAENQNQVSF 114 >SB_11855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 64.1 bits (149), Expect = 1e-10 Identities = 43/89 (48%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 LR LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLRHLRYRLTDVPPQPNSQP 110 Score = 59.7 bits (138), Expect = 3e-09 Identities = 40/95 (42%), Positives = 46/95 (48%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL L H Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLRH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_8557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 64.1 bits (149), Expect = 1e-10 Identities = 43/89 (48%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 LR LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLRHLRYRLTDVPPQPNSQP 110 Score = 59.7 bits (138), Expect = 3e-09 Identities = 40/95 (42%), Positives = 46/95 (48%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL L H Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLRH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_30555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 68 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 69 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSF 63 >SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_26172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 68 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 69 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSF 63 >SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_6437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 68 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 69 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSF 63 >SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_6254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 48/111 (43%), Positives = 57/111 (51%), Gaps = 3/111 (2%) Frame = +3 Query: 435 GEQSNAWRILLRNDRKSRHRRIKKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV- 611 GEQSN WRILLRNDRKSRHRRIKK + FS TS KL LK + ++ Sbjct: 2 GEQSNTWRILLRNDRKSRHRRIKKQRRYERLAATSQLSLWYFSDTSSLKL--LKTKGSIG 59 Query: 612 LSQSLCV--LNIWIKPAFAFCSTRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 + ++C+ N + F L LRY LTDVPPQ NS P Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 47.6 bits (108), Expect = 1e-05 Identities = 26/53 (49%), Positives = 30/53 (56%) Frame = +2 Query: 500 QKARRYERLAATSQXXXXXXXXXXXXXXXYTKGSIGRAFAVPMRTEHLDQASF 658 +K RRYERLAATSQ TKGSIG AF V + TE+ +Q SF Sbjct: 24 KKQRRYERLAATSQLSLWYFSDTSSLKLLKTKGSIGHAFTVCIHTENQNQVSF 76 >SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIPTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 40/94 (42%), Positives = 44/94 (46%), Gaps = 1/94 (1%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RP 609 WVNNPTLGEFCFAMIGRADIEGSKS + P F + L + Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGH 60 Query: 610 CFRSPYAY*TSGSSQLLPFAPREVSVLAELALGH 711 F PF E+SVL EL LGH Sbjct: 61 AFTVCIPTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIPTENQNQVSF 76 >SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) Length = 276 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 68 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 69 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSF 63 >SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 63 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 120 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 121 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 150 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 40 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 98 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 99 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 133 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 93 TKGSIGHAFTVCIHTENQNQVSF 115 >SB_38049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 68 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 69 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSF 63 >SB_34847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 68 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 69 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSF 63 >SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 63 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 120 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 121 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 150 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 40 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 98 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 99 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 133 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 93 TKGSIGHAFTVCIHTENQNQVSF 115 >SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_19329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 68 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 69 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSF 63 >SB_18891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_17342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 68 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 69 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSF 63 >SB_16538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 68 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 69 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 98 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 41 TKGSIGHAFTVCIHTENQNQVSF 63 >SB_11715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_9762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_9131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_7799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_3610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_2425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.7 bits (148), Expect = 2e-10 Identities = 43/90 (47%), Positives = 52/90 (57%), Gaps = 3/90 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPPG 761 L LRY LTDVPPQ NS PG Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQPG 111 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_45086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 63.3 bits (147), Expect = 2e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 40 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 98 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 99 HAFTVCIHTENQNQVSFFPFVLHEISVLIELTLGH 133 Score = 62.5 bits (145), Expect = 4e-10 Identities = 43/89 (48%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N F F Sbjct: 63 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFFPFVL 120 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 121 HEISVLIELTLGHLRYRLTDVPPQPNSQP 149 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 93 TKGSIGHAFTVCIHTENQNQVSF 115 >SB_12651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 40/94 (42%), Positives = 44/94 (46%), Gaps = 1/94 (1%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RP 609 WVNNPTLGEFCFAMIGRADIEGSKS + P F + L + Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGH 60 Query: 610 CFRSPYAY*TSGSSQLLPFAPREVSVLAELALGH 711 F PF E+SVL EL LGH Sbjct: 61 AFTVCIHTENQNQESFYPFVLHEISVLIELTLGH 94 Score = 62.5 bits (145), Expect = 4e-10 Identities = 42/89 (47%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQESFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQESF 76 >SB_11272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSMG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 60.9 bits (141), Expect = 1e-09 Identities = 40/87 (45%), Positives = 44/87 (50%), Gaps = 1/87 (1%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*A-VLSQSLCVLNIWIKPAFAFCSTR 677 K +VAMNAWLPQASYPCGNFS TS KL K + + N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSMGHAFTVCIHTENQNQVSFYPFVLHE 83 Query: 678 GFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 84 ISVLIELTLGHLRYRLTDVPPQPNSQP 110 >SB_59795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_59629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_59435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_59322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_59273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_58838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_58236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_58166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_57954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_57855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_57734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_57679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_57548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_57447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_57431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_57134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 2 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 60 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 61 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 95 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 25 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 82 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 83 HEISVLIELTLGHLRYRLTDVPPQPNSQP 111 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSF 77 >SB_56539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_56489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_56207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_55667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_55559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_55257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_54856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 40/94 (42%), Positives = 44/94 (46%), Gaps = 1/94 (1%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RID-RP 609 WVNNPTLGEFCFAMIGRADIEGSKS + P F + L + Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGH 60 Query: 610 CFRSPYAY*TSGSSQLLPFAPREVSVLAELALGH 711 F PF E+SVL EL LGH Sbjct: 61 AFTVGIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 40/87 (45%), Positives = 44/87 (50%), Gaps = 1/87 (1%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*A-VLSQSLCVLNIWIKPAFAFCSTR 677 K +VAMNAWLPQASYPCGNFS TS KL K + + N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVGIHTENQNQVSFYPFVLHE 83 Query: 678 GFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 84 ISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.5 bits (68), Expect = 0.79 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVGIHTENQNQVSF 76 >SB_54808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_54797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_54633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_54469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_54312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_54150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_54050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_53307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_52629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_52223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_52121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_52051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_52047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_52018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_51960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_51363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_51138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_50827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_50804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_50718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_50571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_50429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_49955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_49750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_49713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_49527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_49345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_48753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_48613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_48492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_48241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 97 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 98 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 132 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 62 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 119 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 120 HEISVLIELTLGHLRYRLTDVPPQPNSQP 148 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSF 114 >SB_47895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_47710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_47495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_47119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_46823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_45848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_45785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_45636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_45505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_45134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_44526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_44415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_44225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_43783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_43656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_43365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_43347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_43311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_43166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_42995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_42977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_42935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_42703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_42453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_42071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_41848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_41713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_41065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_40997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 97 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 98 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 132 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 62 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 119 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 120 HEISVLIELTLGHLRYRLTDVPPQPNSQP 148 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSF 114 >SB_40982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_40731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_40297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 70 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 128 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 129 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 163 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 93 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 150 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 151 HEISVLIELTLGHLRYRLTDVPPQPNSQP 179 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 123 TKGSIGHAFTVCIHTENQNQVSF 145 >SB_39601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_38888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_38243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_37946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_37660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_37454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_36403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_36401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_36395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_36156| Best HMM Match : Attractin (HMM E-Value=7) Length = 162 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 97 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 98 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 132 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 62 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 119 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 120 HEISVLIELTLGHLRYRLTDVPPQPNSQP 148 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSF 114 >SB_36022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_35910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_34585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_34074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_33969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 40 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 98 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 99 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 133 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 63 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 120 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 121 HEISVLIELTLGHLRYRLTDVPPQPNSQP 149 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 93 TKGSIGHAFTVCIHTENQNQVSF 115 >SB_32813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_32518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_32435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_32424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_32043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 2 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 60 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 61 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 95 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 25 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 82 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 83 HEISVLIELTLGHLRYRLTDVPPQPNSQP 111 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSF 77 >SB_31890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_31667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_31404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_31313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_31057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_30731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 40 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 98 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 99 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 133 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 63 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 120 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 121 HEISVLIELTLGHLRYRLTDVPPQPNSQP 149 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 93 TKGSIGHAFTVCIHTENQNQVSF 115 >SB_30487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_30379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_29833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_29810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_29674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_29486| Best HMM Match : Pep_M12B_propep (HMM E-Value=6.4) Length = 128 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_29442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_28891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_28554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_28472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_28051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_26908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_26877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_26801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_26799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_26696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_26674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_26331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_25731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_25678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_25507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 97 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 98 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 132 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 62 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 119 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 120 HEISVLIELTLGHLRYRLTDVPPQPNSQP 148 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSF 114 >SB_25343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_25229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_25042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_24911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_24535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_24410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_24264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_24129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_23820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_23187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_23177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_23165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_22936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_22702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 2 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 60 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 61 HAFTVCIHTENQNQVSSYPFVLHEISVLIELTLGH 95 Score = 62.5 bits (145), Expect = 4e-10 Identities = 42/89 (47%), Positives = 52/89 (58%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N ++ F Sbjct: 25 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSSYPFVL 82 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 83 HEISVLIELTLGHLRYRLTDVPPQPNSQP 111 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/29 (51%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQ-ASFCLLLH 673 TKGSIG AF V + TE+ +Q +S+ +LH Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSSYPFVLH 83 >SB_22021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_21932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 2 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 60 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 61 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 95 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 25 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 82 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 83 HEISVLIELTLGHLRYRLTDVPPQPNSQP 111 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 55 TKGSIGHAFTVCIHTENQNQVSF 77 >SB_21850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_21638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_21300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 19 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 77 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 78 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 112 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 42 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 99 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 100 HEISVLIELTLGHLRYRLTDVPPQPNSQP 128 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 72 TKGSIGHAFTVCIHTENQNQVSF 94 >SB_21080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_20849| Best HMM Match : Pep_M12B_propep (HMM E-Value=6) Length = 128 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_20615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_20484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 153 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 211 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 212 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 246 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 176 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 233 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 234 HEISVLIELTLGHLRYRLTDVPPQPNSQP 262 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 206 TKGSIGHAFTVCIHTENQNQVSF 228 >SB_20048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_19879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_19661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_19446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_19111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_19073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_18952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_18919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 39 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 97 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 98 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 132 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 62 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 119 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 120 HEISVLIELTLGHLRYRLTDVPPQPNSQP 148 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 92 TKGSIGHAFTVCIHTENQNQVSF 114 >SB_18766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_18410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_18356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_17667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_17578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_17562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_17531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_17236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_17164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_17111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_16947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_16865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_16730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 >SB_16490| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 62.9 bits (146), Expect = 3e-10 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 2/95 (2%) Frame = +1 Query: 433 WVNNPTLGEFCFAMIGRADIEGSKSTSL*TLGCHKPVIPVVTFLAPLAKNSLY*RIDRPC 612 WVNNPTLGEFCFAMIGRADIEGSKS + P F + + L Sbjct: 1 WVNNPTLGEFCFAMIGRADIEGSKSNVAMNAWLPQASYPCGNF-SDTSSLKLLKTKGSIG 59 Query: 613 FRSPYAY*TSGSSQL--LPFAPREVSVLAELALGH 711 T +Q+ PF E+SVL EL LGH Sbjct: 60 HAFTVCIHTENQNQVSFYPFVLHEISVLIELTLGH 94 Score = 61.3 bits (142), Expect = 9e-10 Identities = 42/89 (47%), Positives = 51/89 (57%), Gaps = 3/89 (3%) Frame = +3 Query: 501 KKHVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AV-LSQSLCV--LNIWIKPAFAFCS 671 K +VAMNAWLPQASYPCGNFS TS KL LK + ++ + ++C+ N + F Sbjct: 24 KSNVAMNAWLPQASYPCGNFSDTSSLKL--LKTKGSIGHAFTVCIHTENQNQVSFYPFVL 81 Query: 672 TRGFCPR*AGLRTLRYSLTDVPPQSNSPP 758 L LRY LTDVPPQ NS P Sbjct: 82 HEISVLIELTLGHLRYRLTDVPPQPNSQP 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +2 Query: 590 TKGSIGRAFAVPMRTEHLDQASF 658 TKGSIG AF V + TE+ +Q SF Sbjct: 54 TKGSIGHAFTVCIHTENQNQVSF 76 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,197,466 Number of Sequences: 59808 Number of extensions: 524251 Number of successful extensions: 4930 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2092 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4925 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2119930593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -