BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1370 (692 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0346 + 21191542-21191783,21191988-21192072,21192159-211924... 30 1.5 >01_05_0346 + 21191542-21191783,21191988-21192072,21192159-21192422, 21192518-21192820,21193695-21193799,21193916-21194020, 21194613-21194712,21195614-21195933,21196183-21196359, 21196432-21196560,21196592-21196636,21196851-21197078 Length = 700 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 85 YESYFEYLNSAKTPISISQYFTLLRVNL*KSLVSVC 192 Y SYF+YL ++ P Q + +R N + VSVC Sbjct: 125 YSSYFKYLGLSRNPARALQVYGAIRENPTRIHVSVC 160 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,060,182 Number of Sequences: 37544 Number of extensions: 243540 Number of successful extensions: 343 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 338 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 343 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -