BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1363 (672 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY121698-1|AAM52025.1| 1228|Drosophila melanogaster RE70806p pro... 29 4.4 AF210316-1|AAF19446.1| 1235|Drosophila melanogaster hibris protein. 29 4.4 AE013599-2004|AAF58172.3| 1228|Drosophila melanogaster CG7449-PA... 29 4.4 AE013599-2003|AAO41390.1| 1235|Drosophila melanogaster CG7449-PB... 29 4.4 >AY121698-1|AAM52025.1| 1228|Drosophila melanogaster RE70806p protein. Length = 1228 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 186 TWRKRSSPFKTPA*SGSRTLPGGSLTGAVHLSKNNAGV 299 TW K P + + SG R + G LS+N+AGV Sbjct: 678 TWTKDGLPISSNSLSGQRLISDGPRLNISRLSRNDAGV 715 >AF210316-1|AAF19446.1| 1235|Drosophila melanogaster hibris protein. Length = 1235 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 186 TWRKRSSPFKTPA*SGSRTLPGGSLTGAVHLSKNNAGV 299 TW K P + + SG R + G LS+N+AGV Sbjct: 678 TWTKDGLPISSNSLSGQRLISDGPRLNISRLSRNDAGV 715 >AE013599-2004|AAF58172.3| 1228|Drosophila melanogaster CG7449-PA, isoform A protein. Length = 1228 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 186 TWRKRSSPFKTPA*SGSRTLPGGSLTGAVHLSKNNAGV 299 TW K P + + SG R + G LS+N+AGV Sbjct: 678 TWTKDGLPISSNSLSGQRLISDGPRLNISRLSRNDAGV 715 >AE013599-2003|AAO41390.1| 1235|Drosophila melanogaster CG7449-PB, isoform B protein. Length = 1235 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +3 Query: 186 TWRKRSSPFKTPA*SGSRTLPGGSLTGAVHLSKNNAGV 299 TW K P + + SG R + G LS+N+AGV Sbjct: 678 TWTKDGLPISSNSLSGQRLISDGPRLNISRLSRNDAGV 715 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,147,946 Number of Sequences: 53049 Number of extensions: 687617 Number of successful extensions: 1703 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1703 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2910007350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -