BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1362 (728 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP23A10.11c |||conserved fungal protein|Schizosaccharomyces po... 31 0.17 SPBC1198.11c |reb1|SPBC660.01c|RNA polymerase I transcription te... 28 1.6 SPAC23G3.12c |||serine protease |Schizosaccharomyces pombe|chr 1... 27 3.6 SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccha... 27 3.6 SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosa... 27 3.6 SPBC27B12.06 |gpi13||pig-O |Schizosaccharomyces pombe|chr 2|||Ma... 26 6.3 SPBC17D11.02c |||synoviolin homolog|Schizosaccharomyces pombe|ch... 26 6.3 SPCC1322.16 |phb2||prohibitin Phb2|Schizosaccharomyces pombe|chr... 25 8.4 >SPBP23A10.11c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 507 Score = 31.1 bits (67), Expect = 0.17 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 374 HNTKYNQYLKMSTSTCNCNARDRVVYGGNSADSTRE 481 +++ YN+ M TS+C+C++ + YGGN A E Sbjct: 47 YSSTYNEITNMDTSSCSCSSTPK-SYGGNLAPFDEE 81 >SPBC1198.11c |reb1|SPBC660.01c|RNA polymerase I transcription termination factor Reb1|Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 27.9 bits (59), Expect = 1.6 Identities = 8/38 (21%), Positives = 22/38 (57%) Frame = +3 Query: 63 SIVQNVVNNLIIDKRRNTMEYCYKLWVGNGQDIVKKYF 176 +I+ V+N I+D+ + ++C ++W G ++ ++ Sbjct: 247 AIISQEVHNFIMDQGWSEYQFCNQIWAGKCPKTIRMFY 284 >SPAC23G3.12c |||serine protease |Schizosaccharomyces pombe|chr 1|||Manual Length = 996 Score = 26.6 bits (56), Expect = 3.6 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 244 SEVVVSVNELDVFPAMMSLKLNGKYFLTI 158 S V VS + D P ++++K+N YF TI Sbjct: 920 SYVRVSTSTFDKVPVVLTIKMNKHYFPTI 948 >SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 846 Score = 26.6 bits (56), Expect = 3.6 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +2 Query: 371 AHNTKYNQYLKMSTSTCNCNARDRVVYGGNSA 466 +HN +N + + S ++ + +R+ V+ GNS+ Sbjct: 616 SHNEMFNSFHRSSVTSASIKSREAVLSAGNSS 647 >SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 889 Score = 26.6 bits (56), Expect = 3.6 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 66 IVQNVVNNLIIDKRRNTMEYCYKLWVGNGQDIVK 167 +++++ NL I N +EY LW NG I K Sbjct: 447 VLKDIFFNLQIGVTFNILEYLRHLWSNNGDAIAK 480 >SPBC27B12.06 |gpi13||pig-O |Schizosaccharomyces pombe|chr 2|||Manual Length = 918 Score = 25.8 bits (54), Expect = 6.3 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 5/40 (12%) Frame = -1 Query: 179 WEVLFDNILS--VADPQL---VAVLHGVPSLVNDQIVNYI 75 W+VLF + L+ ++ P V LHGV + VN + +YI Sbjct: 188 WDVLFHDYLNETLSQPAFSFNVPDLHGVDNKVNQYVFDYI 227 >SPBC17D11.02c |||synoviolin homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 677 Score = 25.8 bits (54), Expect = 6.3 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = +1 Query: 100 TRDGTPWSTATSCGSATDRILSKSTSH*ALDSSWPEIRQAHLQKLQPRSEARSTTNPS 273 T +G P + ++ + T + S AL W + +++ S++ STTNPS Sbjct: 407 TFNGVPNANSSGFAAHTQDLSSVIPRRIALRDGWTMLPIPGTRRIPTYSQSTSTTNPS 464 >SPCC1322.16 |phb2||prohibitin Phb2|Schizosaccharomyces pombe|chr 3|||Manual Length = 279 Score = 25.4 bits (53), Expect = 8.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 516 RPVLHLQPRIQRCLGARYDRERL 584 RP +H P+I R LG YD L Sbjct: 106 RPDVHALPKIYRTLGGDYDERVL 128 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,825,533 Number of Sequences: 5004 Number of extensions: 56573 Number of successful extensions: 193 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 193 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -