BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1362 (728 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0057 + 12460986-12461036,12461108-12461161,12461420-124614... 38 0.011 >10_07_0057 + 12460986-12461036,12461108-12461161,12461420-12461482, 12461666-12461716,12461996-12462057,12462156-12462318, 12462829-12462939,12463029-12463166,12463248-12463322, 12463420-12463540,12464827-12464981,12465080-12465154, 12465270-12465473,12465670-12465786 Length = 479 Score = 37.5 bits (83), Expect = 0.011 Identities = 26/70 (37%), Positives = 36/70 (51%) Frame = -2 Query: 301 NTIAVEFSHSRDWLWNELQSEVVVSVNELDVFPAMMSLKLNGKYFLTISCPLPTHSL*QY 122 N+I EF + D NEL S + + D MM L + GK I CP+P+HSL Sbjct: 122 NSIVSEFRANADKYGNELSSNLTI----FDRVHMMMHLLIRGKKD-GILCPIPSHSLYTD 176 Query: 121 SMVFRLLSMI 92 SMV R +++ Sbjct: 177 SMVLRGATLV 186 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,677,273 Number of Sequences: 37544 Number of extensions: 376613 Number of successful extensions: 1137 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1137 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -