BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1358 (771 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 72 4e-13 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 51 9e-07 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 47 1e-05 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 46 3e-05 SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.084 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.084 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.45 SB_10132| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.45 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 31 0.78 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_1848| Best HMM Match : Galactosyl_T (HMM E-Value=1.4e-26) 31 1.4 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_54195| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_46486| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.7) 30 1.8 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 29 4.2 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 72.1 bits (169), Expect = 4e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +2 Query: 611 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 72.1 bits (169), Expect = 4e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +2 Query: 611 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 72.1 bits (169), Expect = 4e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +2 Query: 611 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 80 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 119 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.8 bits (131), Expect = 2e-08 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +2 Query: 611 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 TAGR + ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRVAMEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +2 Query: 632 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 9 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 41 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +2 Query: 632 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +2 Query: 632 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 638 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 638 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 638 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 638 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 638 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 638 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 638 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 638 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 638 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 638 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +2 Query: 638 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 730 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 10 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 641 SAKECATTHLPKQPALKMDGAEAFCLYTTV 730 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 641 SAKECATTHLPKQPALKMDGAEAFCLYTTV 730 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 641 SAKECATTHLPKQPALKMDGAEAFCLYTTV 730 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 641 SAKECATTHLPKQPALKMDGAEAFCLYTTV 730 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +2 Query: 644 AKECATTHLPKQPALKMDGAEAFCLYTTV 730 AKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 39 AKECVTTHLPKQLALKMDGAQASHLYRAV 67 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 558 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 650 + +RS D KGVG S QQDGGHGS NP + Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPAK 40 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/36 (63%), Positives = 25/36 (69%) Frame = +3 Query: 558 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 665 + +RS D KGVG S QQDGGHGS NPLR QRL Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPLRKGQRL 45 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 46.4 bits (105), Expect = 3e-05 Identities = 30/64 (46%), Positives = 35/64 (54%) Frame = -1 Query: 618 PAVMSDQRLSWCPMSVF*AP*TTFGSSHSASSAYQNCPLGTVIRSPASSFE*AGVLTHLK 439 P V SD+R W P F GSS ASS YQN P T I P + + G+LT+LK Sbjct: 62 PFVGSDERRLWHPYRAF-------GSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLLTNLK 113 Query: 438 FENR 427 FENR Sbjct: 114 FENR 117 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 251 NRYGPPSGFPLTST*PGIVHHLSGPSICA 165 NRY PP FPL S GIVHHLSGP+ CA Sbjct: 1 NRYEPPPEFPLASPYSGIVHHLSGPNRCA 29 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -1 Query: 252 ESLRSSIRVSPDFDLTRHSSPSFGSQHLCS 163 ESLR+S RVS F L RHSSPSFGSQ + S Sbjct: 35 ESLRASTRVSSGFTLFRHSSPSFGSQQMRS 64 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +2 Query: 647 KECATTHLPKQPALKMDGAEAFCLYTTV 730 KEC TT LPKQ ALKMDGA+A LY V Sbjct: 40 KECVTTPLPKQLALKMDGAQASHLYRAV 67 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = +3 Query: 558 KAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 650 + +RS D KGVG S QQDGGHGS NPL+ Sbjct: 10 RCQSRRSSDPTKGVGCSRQQDGGHGSWNPLK 40 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +1 Query: 571 NAHGTP*KALVAHDSRTVAMEVGIR 645 +AH TP K LVA DSRTVAMEVGIR Sbjct: 9 DAHQTPQKVLVALDSRTVAMEVGIR 33 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +2 Query: 632 KSESAKECATTHLPKQPALKM 694 K ESAKEC TTHLPKQ ALKM Sbjct: 2 KVESAKECVTTHLPKQLALKM 22 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = -1 Query: 549 FGSSHSASSAYQNCPLGTVIRSPAS 475 FGSS ASSAYQN PLGT I PAS Sbjct: 21 FGSSRIASSAYQNGPLGTRIHCPAS 45 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 34.7 bits (76), Expect = 0.084 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 719 IGKTLQRHPFSGLVASA 669 IG TL+RHPFSGLVASA Sbjct: 24 IGATLERHPFSGLVASA 40 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -3 Query: 607 ERPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 E+PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 41 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 85 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 34.7 bits (76), Expect = 0.084 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 719 IGKTLQRHPFSGLVASA 669 IG TL+RHPFSGLVASA Sbjct: 22 IGATLERHPFSGLVASA 38 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -3 Query: 607 ERPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 E+PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 39 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTSNSHSLSGF 83 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 34.3 bits (75), Expect = 0.11 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = -3 Query: 604 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGFIVRVSRSSHPFKV 437 +PTPF+ S ER L LN + + K PT + H +SGF SR+S+ FKV Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGFNY-ASRTSYQFKV 57 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 33.1 bits (72), Expect = 0.25 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 251 NRYGPPSGFPLTST*PGIVHH 189 NRY PP FPL S GIVHH Sbjct: 1 NRYEPPPEFPLASPYSGIVHH 21 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 32.3 bits (70), Expect = 0.45 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -3 Query: 607 ERPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 E+PTPF+ S ER L LN + + L K PT + H +SGF Sbjct: 58 EQPTPFVGSDERRLWHLNRAFGSSRIASSALQKWPTRNSHSLSGF 102 >SB_10132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/63 (25%), Positives = 25/63 (39%) Frame = -3 Query: 628 WPPSCCHERPTPFMVSHERFLGALNYVWFIPQRQFCLPKLPTWHRHQISGFIVRVSRSSH 449 W P P P + +H + A W P + P LP W H ++G + + Sbjct: 34 WTPHSLTRHPYPLLDTHIPYWTAHIPYW-TPYLPYWTPYLPYWTPHSLTGHLASPTPDRD 92 Query: 448 PFK 440 P+K Sbjct: 93 PYK 95 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 31.5 bits (68), Expect = 0.78 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = -3 Query: 628 WPPSCCH--ERPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 W P + E+PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 71 WLPQASYPCEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 124 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 31.1 bits (67), Expect = 1.0 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -3 Query: 610 HERPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 +E+PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 122 YEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 167 >SB_1848| Best HMM Match : Galactosyl_T (HMM E-Value=1.4e-26) Length = 308 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 171 NAGTRKMVNYAWSGRSQGKP*WRTVAILRANRSSE 275 NA RK + + W P WRTV ++ AN + E Sbjct: 75 NAARRKEIRFTWGTDFLPSPRWRTVFLIGANDNQE 109 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -1 Query: 300 ISLSPLYPVPTIDLHAES 247 ISLSPLYP TIDLH S Sbjct: 38 ISLSPLYPNLTIDLHVRS 55 >SB_54195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 171 NAGTRKMVNYAWSGRSQGKP*WRTVAILRANRSSE 275 NA RK + + W P WRTV ++ AN + E Sbjct: 79 NAARRKEIRFTWGTDFLPTPRWRTVFLIGANDNQE 113 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -3 Query: 607 ERPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 E+PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 38 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 82 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -3 Query: 607 ERPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 E+PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 39 EQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 83 >SB_46486| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.7) Length = 703 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = +2 Query: 158 RSEHKCWDPKD--GELCLVRSKSGETLMEDRSDSACKSIVGTGYRGERLIEPSSSWFRPK 331 +++ C D ++ GE +KS +T D S ++C+S++ TG + L + S RP+ Sbjct: 303 QNDLSCSDSENEGGESFSTTAKSKDTKANDYSMTSCRSVLATGLNEQSLAKRKESIRRPE 362 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -3 Query: 604 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 +PTPF+ S ER L LN+ + + K PT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNHAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 663 VVAHSLADSDFHGHRPAVMSDQRLSWCPMSVF 568 + H + ++DF G R A+M+D +L C S+F Sbjct: 386 LTTHFMDEADFLGDRIAIMADGQLRCCGSSLF 417 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 28.7 bits (61), Expect = 5.5 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 604 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 +PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAYGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 604 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 +PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 604 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 +PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 604 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 +PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 604 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 +PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 604 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 +PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTKNSHSLSGF 45 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 604 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 +PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 604 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 +PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 604 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 +PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 604 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 +PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 604 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 +PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 604 RPTPFMVSHERFLGALNYVWFIPQ-RQFCLPKLPTWHRHQISGF 476 +PTPF+ S ER L LN + + K PT + H +SGF Sbjct: 2 QPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,864,347 Number of Sequences: 59808 Number of extensions: 554060 Number of successful extensions: 1207 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 1094 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1204 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -