BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1358 (771 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276485-1|CAB81951.1| 283|Homo sapiens integral membrane trans... 39 0.023 BC047726-1|AAH47726.1| 273|Homo sapiens OAF homolog (Drosophila... 34 0.65 AY459296-1|AAR23238.1| 273|Homo sapiens NS5ATP13TP2 protein. 34 0.65 >AJ276485-1|CAB81951.1| 283|Homo sapiens integral membrane transporter protein protein. Length = 283 Score = 38.7 bits (86), Expect = 0.023 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +3 Query: 189 MVNYAWSGRSQGKP*WRTVAIL 254 MVNYAW+GRSQ K WR+VA+L Sbjct: 1 MVNYAWAGRSQRKLWWRSVAVL 22 >BC047726-1|AAH47726.1| 273|Homo sapiens OAF homolog (Drosophila) protein. Length = 273 Score = 33.9 bits (74), Expect = 0.65 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 5/52 (9%) Frame = -3 Query: 658 CTLLSGFRLPWPPSC---CH--ERPTPFMVSHERFLGALNYVWFIPQRQFCL 518 C G L W P CH +RPTP+ + ++ +++PQRQ CL Sbjct: 214 CVCRYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQRQLCL 265 >AY459296-1|AAR23238.1| 273|Homo sapiens NS5ATP13TP2 protein. Length = 273 Score = 33.9 bits (74), Expect = 0.65 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 5/52 (9%) Frame = -3 Query: 658 CTLLSGFRLPWPPSC---CH--ERPTPFMVSHERFLGALNYVWFIPQRQFCL 518 C G L W P CH +RPTP+ + ++ +++PQRQ CL Sbjct: 214 CVCRYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQRQLCL 265 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,455,192 Number of Sequences: 237096 Number of extensions: 2677695 Number of successful extensions: 8345 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8345 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9311505506 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -