SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVm1355
         (650 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone recepto...    22   3.8  
AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory recept...    22   5.0  
AF264718-1|AAF75271.1|  125|Tribolium castaneum putative cytochr...    21   6.7  
AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory recept...    21   8.8  
AM292335-1|CAL23147.2|  374|Tribolium castaneum gustatory recept...    21   8.8  
AF265300-1|AAG17643.1|  126|Tribolium castaneum putative cytochr...    21   8.8  

>AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone receptor
           (isoform A) protein.
          Length = 549

 Score = 22.2 bits (45), Expect = 3.8
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +2

Query: 182 RAGGYHYPAYFC 217
           RA GYHY A  C
Sbjct: 194 RASGYHYNALTC 205


>AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory receptor
           candidate 15 protein.
          Length = 455

 Score = 21.8 bits (44), Expect = 5.0
 Identities = 8/23 (34%), Positives = 12/23 (52%)
 Frame = +1

Query: 427 FIFVYSIFFLNRTSKYETCNNLN 495
           F+F +    L   S +E+C  LN
Sbjct: 391 FMFSFGFILLRFLSVFESCTRLN 413


>AF264718-1|AAF75271.1|  125|Tribolium castaneum putative cytochrome
           P450 monooxigenaseCYP4Q6 protein.
          Length = 125

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 10/33 (30%), Positives = 17/33 (51%)
 Frame = -2

Query: 265 LQRLPTLQTETHYCFTAEIGRVVVPTRADSQEV 167
           L  L  +QT+      + +G+  +PT  D QE+
Sbjct: 12  LANLQDIQTKVREEILSVVGKEKIPTYNDLQEL 44


>AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory receptor
           candidate 49 protein.
          Length = 418

 Score = 21.0 bits (42), Expect = 8.8
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -2

Query: 583 LFTFSLLHLCF 551
           ++TF+L +LCF
Sbjct: 316 IYTFNLFYLCF 326


>AM292335-1|CAL23147.2|  374|Tribolium castaneum gustatory receptor
           candidate 14 protein.
          Length = 374

 Score = 21.0 bits (42), Expect = 8.8
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -2

Query: 583 LFTFSLLHLCF 551
           ++TF+L +LCF
Sbjct: 272 IYTFNLFYLCF 282


>AF265300-1|AAG17643.1|  126|Tribolium castaneum putative cytochrome
           P450 monooxigenase protein.
          Length = 126

 Score = 21.0 bits (42), Expect = 8.8
 Identities = 5/11 (45%), Positives = 10/11 (90%)
 Frame = +3

Query: 426 FYICLLNIFPK 458
           F+IC+L ++P+
Sbjct: 7   FFICILGVYPE 17


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 157,174
Number of Sequences: 336
Number of extensions: 3427
Number of successful extensions: 6
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16760905
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -