BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1355 (650 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1461 - 27299891-27301870 28 7.4 06_01_0983 - 7630651-7630683,7630717-7630942,7630993-7631234,763... 28 7.4 11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665,794... 27 9.8 >08_02_1461 - 27299891-27301870 Length = 659 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -1 Query: 251 HPSNRNALLLHGRNRQGSGTHPRGLTRGPTTS 156 H ++ LL GR R G G H RGL P S Sbjct: 282 HAADLRKKLLRGRRRGGGGGHRRGLFVFPLVS 313 >06_01_0983 - 7630651-7630683,7630717-7630942,7630993-7631234, 7631502-7631591,7631680-7631845,7632225-7633191, 7633402-7633591,7633908-7634048,7634416-7634736 Length = 791 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -3 Query: 567 YYTSASKTPNCSPLYIIT*S*KDKIQIITCFVFAS 463 Y S+ KT PL I +D IQ CFVFA+ Sbjct: 682 YMRSSKKTIQNYPLIFIDGPKQDNIQTYPCFVFAN 716 >11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665, 7940762-7940809,7941488-7941584,7941688-7941767, 7941841-7941912,7942256-7942350,7943903-7943984, 7945176-7945209,7945255-7945262,7945657-7946058 Length = 505 Score = 27.5 bits (58), Expect = 9.8 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 10 YNYTGTXMLEYHNHLQHKH 66 Y+Y YHNH QH H Sbjct: 404 YHYHNNNQQSYHNHQQHNH 422 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,916,054 Number of Sequences: 37544 Number of extensions: 303793 Number of successful extensions: 524 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 516 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 524 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -