BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1355 (650 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 6.3 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 6.3 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 23 8.4 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -2 Query: 244 QTETHYCFTAEIGRVVVPTRADSQEVLPPVIK 149 Q ET C+T+ ++ QEV P +K Sbjct: 1179 QNETLSCYTSRRNSTTSNANSEPQEVAPQFVK 1210 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.4 bits (48), Expect = 6.3 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -2 Query: 232 HYCFTAEIGRVVVPTRADSQEVLP 161 H F AEIG +V DS E+LP Sbjct: 939 HIEFHAEIGMSLVLKVGDSSEMLP 962 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.0 bits (47), Expect = 8.4 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +1 Query: 376 THLSNKKNIGIITIHWYF 429 T ++KK GII ++W + Sbjct: 933 TQFTSKKKTGIIDVYWLY 950 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 667,588 Number of Sequences: 2352 Number of extensions: 13893 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -