BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1355 (650 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81545-8|CAB04444.1| 327|Caenorhabditis elegans Hypothetical pr... 30 1.2 AC024874-1|AAK31571.1| 169|Caenorhabditis elegans Hypothetical ... 29 2.9 AF068709-5|AAC19250.2| 332|Caenorhabditis elegans Serpentine re... 28 6.6 Z92782-9|CAE17814.1| 329|Caenorhabditis elegans Hypothetical pr... 27 8.7 Z78545-4|CAE17854.1| 106|Caenorhabditis elegans Hypothetical pr... 27 8.7 U61948-5|AAB03149.2| 509|Caenorhabditis elegans Hypothetical pr... 27 8.7 >Z81545-8|CAB04444.1| 327|Caenorhabditis elegans Hypothetical protein F49H6.11 protein. Length = 327 Score = 30.3 bits (65), Expect = 1.2 Identities = 21/74 (28%), Positives = 38/74 (51%) Frame = -1 Query: 575 IFLITPLLLRHQIVPLYT*LHNLKKIKFKLLHVSYLLVLFRKNIE*TNIKYQCIVMIPIF 396 I ++ L + + +P Y +HNLKK K K L + + F K ++ + + ++ I +F Sbjct: 20 IAMLVSLFISYLTLPFYFYVHNLKKHKEKNLPI---VKFFYKAVKLSYFVF-IVLAIVLF 75 Query: 395 FLLLRWVDELTAHL 354 F + R + AHL Sbjct: 76 FCISRESNSTKAHL 89 >AC024874-1|AAK31571.1| 169|Caenorhabditis elegans Hypothetical protein Y92C3A.3 protein. Length = 169 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 623 LFKNFLPLYN*NLTVHIFLITPLLLRHQIVP 531 L K+FLP+YN + H F I L++ HQ P Sbjct: 128 LIKDFLPIYN-LIKAHRFAIHQLVIEHQEKP 157 >AF068709-5|AAC19250.2| 332|Caenorhabditis elegans Serpentine receptor, class t protein29 protein. Length = 332 Score = 27.9 bits (59), Expect = 6.6 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = -1 Query: 533 PLYT*LHNLKKIKFKLLHVSYLLVLFRKNIE*TNIKYQC---IVMIPIFFLLLRWVDELT 363 PLY + + F +L++ L VLF K NIK C ++ + +L WV+ +T Sbjct: 35 PLYGIADMIYGLTFNMLYIPILSVLFEKE----NIKMSCFKIMIFLASVDMLALWVNSIT 90 >Z92782-9|CAE17814.1| 329|Caenorhabditis elegans Hypothetical protein F14F8.12 protein. Length = 329 Score = 27.5 bits (58), Expect = 8.7 Identities = 18/82 (21%), Positives = 39/82 (47%), Gaps = 2/82 (2%) Frame = -1 Query: 587 LTVHIFLITPLLLRHQIVPLYT*LHNLKKIKFKLLHVSYLLVLFRKNIE*TNIKYQCIVM 408 ++ + LI ++ + +P Y +HNL + + K+ +LF + T + Y Sbjct: 16 ISSELILIFICIVSYSTLPFYIYVHNLNRHREKVEMGQNYFILFCFEVGLTVVDYFIATF 75 Query: 407 IPIFFLL--LRWVDELTAHLVL 348 I +F +L + + + T H++L Sbjct: 76 ILLFIILFYILHILQQTFHVIL 97 >Z78545-4|CAE17854.1| 106|Caenorhabditis elegans Hypothetical protein M03B6.5 protein. Length = 106 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +1 Query: 379 HLSNKKNIGIITIHWYFIFVYSIFFL 456 H N++NIG I+I W++ FV + FL Sbjct: 68 HPQNRRNIGDISIVWFY-FVLLMLFL 92 >U61948-5|AAB03149.2| 509|Caenorhabditis elegans Hypothetical protein C46A5.2 protein. Length = 509 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Frame = -3 Query: 645 YKNLFSCFIQKLFTSVQLKFNCSHFPYY----TSASKTPNCSPLYII 517 Y+ F+CF+ K + ++NC+ PYY + P C P I+ Sbjct: 355 YQGKFTCFVYKWLMQLIEQYNCT-VPYYKYTLSYLKDVPICEPDVIV 400 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,356,410 Number of Sequences: 27780 Number of extensions: 294897 Number of successful extensions: 639 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 639 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -