BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1354 (669 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g05084.1 68415.m00532 hypothetical protein 30 1.2 At1g72840.1 68414.m08425 disease resistance protein (TIR-NBS-LRR... 29 2.8 At5g34950.1 68418.m04124 replication protein-related weak simila... 29 3.7 >At2g05084.1 68415.m00532 hypothetical protein Length = 258 Score = 30.3 bits (65), Expect = 1.2 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +3 Query: 363 NSIFYNIYWSKY-NIFSTTFFRFSWNTSTIFRLSRLIYFMKYNFF 494 N I I W +Y N F TT F W FRL R KY F Sbjct: 48 NRIDARIPWGEYMNNFKTTLFEGKWYYLQHFRLKRATTIPKYTDF 92 >At1g72840.1 68414.m08425 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1183 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +3 Query: 318 ISFIYRPFIKXLYTKNSIFYNIYWSKYNIFSTTFFRFSWNTSTIFRLSRL 467 IS + R F+ Y++ + F + +KY+I ST R SW +L ++ Sbjct: 1021 ISDLVRDFMNEEYSQEAPFRLVCITKYSIASTNNMRTSWREPMRIKLPKI 1070 >At5g34950.1 68418.m04124 replication protein-related weak similarity to Replication Protein A 70 kDa DNA-binding subunit (RP-A) (RF-A) (Replication factor-A protein 1) (Single-stranded DNA-binding protein) (DMRPA1) (GI:2498844)(SP:Q24492) [Drosophila melanogaster] Length = 234 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +3 Query: 363 NSIFYNIYWSKY-NIFSTTFFRFSWNTSTIFRLSRLIYFMKYNFF 494 N I I W +Y N F T F W FRL R KY F Sbjct: 48 NKIDARIPWGEYMNNFKTNLFEGKWYYLQHFRLKRATTIPKYTDF 92 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,929,775 Number of Sequences: 28952 Number of extensions: 158606 Number of successful extensions: 292 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 287 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 292 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -