BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1353 (657 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 165 2e-41 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 165 3e-41 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 3e-28 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 4e-28 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 5e-28 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 1e-27 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 6e-25 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 1e-23 SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 106 1e-23 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 6e-23 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 7e-23 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 1e-22 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 102 2e-22 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 7e-22 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 93 2e-19 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) 93 2e-19 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 93 2e-19 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 93 2e-19 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 93 2e-19 SB_21148| Best HMM Match : PAN (HMM E-Value=0.49) 93 2e-19 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 93 2e-19 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 2e-17 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 86 3e-17 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 8e-16 SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 74 1e-13 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) 63 2e-10 SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 62 5e-10 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 61 7e-10 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 7e-10 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 61 7e-10 SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0) 61 7e-10 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 60 1e-09 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 60 1e-09 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 60 2e-09 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) 60 2e-09 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 60 2e-09 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 60 2e-09 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) 60 2e-09 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 60 2e-09 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 60 2e-09 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 60 2e-09 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) 60 2e-09 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 60 2e-09 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 60 2e-09 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 60 2e-09 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 60 2e-09 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 60 2e-09 SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 60 2e-09 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 60 2e-09 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 60 2e-09 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 60 2e-09 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 60 2e-09 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) 60 2e-09 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 60 2e-09 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 60 2e-09 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 60 2e-09 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 60 2e-09 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 60 2e-09 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 60 2e-09 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 60 2e-09 SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 60 2e-09 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 60 2e-09 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 60 2e-09 SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) 60 2e-09 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 60 2e-09 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) 60 2e-09 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 60 2e-09 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 60 2e-09 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 60 2e-09 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 60 2e-09 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) 60 2e-09 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 60 2e-09 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 60 2e-09 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 60 2e-09 SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 60 2e-09 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 60 2e-09 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 60 2e-09 SB_27070| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 60 2e-09 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_20517| Best HMM Match : Nuclease_act (HMM E-Value=1.4) 60 2e-09 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 60 2e-09 SB_18568| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.5e-22) 60 2e-09 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 60 2e-09 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 60 2e-09 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 60 2e-09 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 60 2e-09 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_11195| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031) 60 2e-09 SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05) 60 2e-09 SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_9135| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_8821| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_8316| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_6860| Best HMM Match : zf-C3HC4 (HMM E-Value=0.14) 60 2e-09 SB_6458| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) 60 2e-09 SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) 60 2e-09 SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) 60 2e-09 SB_4559| Best HMM Match : ICAM_N (HMM E-Value=5.3) 60 2e-09 SB_3948| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_3585| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_3444| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_6296| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 4e-09 SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 58 6e-09 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 58 6e-09 SB_37138| Best HMM Match : RnaseA (HMM E-Value=8) 58 6e-09 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 58 6e-09 SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) 58 8e-09 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_32717| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 58 8e-09 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 57 1e-08 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 57 1e-08 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 57 1e-08 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 57 1e-08 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 57 1e-08 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 57 1e-08 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 57 1e-08 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 57 1e-08 SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 57 1e-08 SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) 57 1e-08 SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) 57 1e-08 SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) 57 1e-08 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 57 1e-08 SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) 57 1e-08 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 57 1e-08 SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) 57 1e-08 SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) 57 1e-08 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 57 1e-08 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 57 1e-08 SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 57 1e-08 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 57 1e-08 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 57 1e-08 SB_56846| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 57 1e-08 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 57 1e-08 SB_44687| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 57 1e-08 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 57 1e-08 SB_29112| Best HMM Match : Mucin (HMM E-Value=1.7) 57 1e-08 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 57 1e-08 SB_26142| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_18550| Best HMM Match : DUF987 (HMM E-Value=4.4) 57 1e-08 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 57 1e-08 SB_16872| Best HMM Match : ARM_1 (HMM E-Value=0) 57 1e-08 SB_9530| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) 57 1e-08 SB_6524| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_5006| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_3169| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_1434| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 56 2e-08 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 56 2e-08 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 56 2e-08 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 56 2e-08 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 56 2e-08 SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) 56 2e-08 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 56 2e-08 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_53938| Best HMM Match : Gln-synt_N (HMM E-Value=0.78) 56 2e-08 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_36434| Best HMM Match : Ins_allergen_rp (HMM E-Value=5.7) 56 2e-08 SB_33876| Best HMM Match : EGF (HMM E-Value=2.4e-08) 56 2e-08 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_9823| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_6133| Best HMM Match : ABC_tran (HMM E-Value=9e-09) 56 2e-08 SB_870| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-09) 56 2e-08 SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) 56 3e-08 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 56 3e-08 SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 56 3e-08 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_864| Best HMM Match : Sulfotransfer_1 (HMM E-Value=6.4e-05) 56 3e-08 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 55 4e-08 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 55 4e-08 SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) 55 4e-08 SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 55 4e-08 SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 55 4e-08 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 55 4e-08 SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 55 4e-08 SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 55 4e-08 SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 55 4e-08 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_8298| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 55 4e-08 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 55 4e-08 SB_2218| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_57715| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_55419| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 55 4e-08 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_54385| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_51677| Best HMM Match : DUF327 (HMM E-Value=0.89) 55 4e-08 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 165 bits (402), Expect = 2e-41 Identities = 79/93 (84%), Positives = 82/93 (88%) Frame = +2 Query: 284 QNQGITQERTCEQKASKRPGTVKRPRCWRXSIGSAPLTSITKIDAQVRGGETRQDYKDTR 463 +NQGITQERTCEQKASKRPGTVKRPRCWR SIGSAPLTSITKIDAQVRGGETRQDYKDTR Sbjct: 114 KNQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTR 173 Query: 464 RFPLEAPSCALLFRPAAYRIPVRLSPFGKRGAF 562 RFPLEAPSCALLFRP R+P PF R A+ Sbjct: 174 RFPLEAPSCALLFRPC--RLPDTCPPFSLREAW 204 Score = 60.5 bits (140), Expect = 1e-09 Identities = 31/61 (50%), Positives = 37/61 (60%) Frame = +1 Query: 454 RYQAFPPGSSLVRSPVPTRRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSLAVCTN 633 R+ P +L+ P RLPDTCPPFSLREAWRFLIAHAV I ++F S + Sbjct: 174 RFPLEAPSCALLFRPC---RLPDTCPPFSLREAWRFLIAHAVAIRTAKKTFQGSTSSMAA 230 Query: 634 P 636 P Sbjct: 231 P 231 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 165 bits (401), Expect = 3e-41 Identities = 79/92 (85%), Positives = 81/92 (88%) Frame = +2 Query: 287 NQGITQERTCEQKASKRPGTVKRPRCWRXSIGSAPLTSITKIDAQVRGGETRQDYKDTRR 466 NQGITQERTCEQKASKRPGTVKRPRCWR SIGSAPLTSITKIDAQVRGGETRQDYKDTRR Sbjct: 86 NQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRR 145 Query: 467 FPLEAPSCALLFRPAAYRIPVRLSPFGKRGAF 562 FPLEAPSCALLFRP R+P PF R A+ Sbjct: 146 FPLEAPSCALLFRPC--RLPDTCPPFSLREAW 175 Score = 109 bits (261), Expect = 3e-24 Identities = 52/68 (76%), Positives = 55/68 (80%) Frame = +1 Query: 454 RYQAFPPGSSLVRSPVPTRRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSLAVCTN 633 R+ P +L+ P RLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPS AVCTN Sbjct: 145 RFPLEAPSCALLFRPC---RLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTN 201 Query: 634 PPFSPTAA 657 PPFSPTAA Sbjct: 202 PPFSPTAA 209 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 102 bits (245), Expect(2) = 3e-28 Identities = 48/56 (85%), Positives = 49/56 (87%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE*LIPLAAAER 228 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE PL + R Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFEYGDPLESTCR 71 Score = 40.3 bits (90), Expect(2) = 3e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 102 bits (244), Expect(2) = 4e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 4e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 102 bits (244), Expect(2) = 5e-28 Identities = 45/46 (97%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 5e-28 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 101 bits (241), Expect(2) = 1e-27 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAF+ Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFD 61 Score = 40.3 bits (90), Expect(2) = 1e-27 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect(2) = 6e-25 Identities = 42/46 (91%), Positives = 42/46 (91%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 SGGRSLWK ASNAAFLRFLAF WPFAHMFF ALSPD VDNRITAFE Sbjct: 16 SGGRSLWKNASNAAFLRFLAFGWPFAHMFFRALSPDCVDNRITAFE 61 Score = 40.3 bits (90), Expect(2) = 6e-25 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 566 MRKRHASRREKGGQVSGKR 510 MRKRHASRREKGGQVSG R Sbjct: 1 MRKRHASRREKGGQVSGGR 19 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 107 bits (256), Expect = 1e-23 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -3 Query: 403 DARQGGGAYGXTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSD 254 D QGGGAYG TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLS+ Sbjct: 19 DVGQGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSE 68 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 106 bits (255), Expect = 1e-23 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = +3 Query: 108 LSSRETCRASCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQ 254 L+SRETCRASCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQ Sbjct: 90 LNSRETCRASCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQ 138 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 104 bits (250), Expect = 6e-23 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = -3 Query: 397 RQGGGAYGXTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSD 254 ++GGGAYG TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLS+ Sbjct: 757 KRGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSE 804 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 104 bits (249), Expect = 7e-23 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 394 QGGGAYGXTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSD 254 +GGGAYG TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLS+ Sbjct: 405 EGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSE 451 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 103 bits (248), Expect = 1e-22 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -3 Query: 394 QGGGAYGXTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSD 254 +GGGAYG TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLS+ Sbjct: 554 KGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSE 600 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 103 bits (247), Expect = 1e-22 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 391 GGGAYGXTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSD 254 GGGAYG TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLS+ Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSE 46 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 103 bits (247), Expect = 1e-22 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 391 GGGAYGXTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSD 254 GGGAYG TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLS+ Sbjct: 24 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSE 69 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 103 bits (247), Expect = 1e-22 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -3 Query: 391 GGGAYGXTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSD 254 GGGAYG TPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLS+ Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSE 46 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 103 bits (246), Expect = 2e-22 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +3 Query: 117 RETCRASCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQ 254 RETCRASCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQ Sbjct: 457 RETCRASCINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQ 502 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 102 bits (245), Expect = 2e-22 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = -2 Query: 398 SSGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 +SGGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 57 NSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 103 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 101 bits (241), Expect = 7e-22 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -2 Query: 395 SGGRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 +GGRSLWK ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 92 AGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 137 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 97.1 bits (231), Expect = 1e-20 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -2 Query: 389 GRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 GRSLWK ASNAAFLRFLAFCWPFAHMF+PALSPDSVDNRITAFE Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFAHMFYPALSPDSVDNRITAFE 45 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) Length = 1652 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 44.8 bits (101), Expect = 6e-05 Identities = 20/40 (50%), Positives = 25/40 (62%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGERYQSLKGGNTVIHRIR 293 +C G +PLPRSLTR ARSF CGER + + G + R Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKMAYERGGDFLEDAR 116 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 818 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) Length = 996 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_21148| Best HMM Match : PAN (HMM E-Value=0.49) Length = 183 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) Length = 336 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 92.7 bits (220), Expect = 2e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 86.6 bits (205), Expect = 2e-17 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -2 Query: 389 GRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 G K ASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE Sbjct: 18 GAEPMKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 85.8 bits (203), Expect = 3e-17 Identities = 39/44 (88%), Positives = 39/44 (88%) Frame = -2 Query: 389 GRSLWKXASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 258 GRSLWK ASNAAFLRFLAFCWPF HMF PALSPDSVD ITAFE Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAFE 45 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 81.0 bits (191), Expect = 8e-16 Identities = 41/63 (65%), Positives = 46/63 (73%) Frame = +2 Query: 389 PLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLFRPAAYRIPVRLSPFGKRGAFS* 568 PLTSITK DAQ+ GGETRQDYKDTRRFPL APSCALLF P + +PV +G+ Sbjct: 119 PLTSITKSDAQISGGETRQDYKDTRRFPLAAPSCALLFLP--FGLPVSFRCYGRVCLIPR 176 Query: 569 LTL 577 LTL Sbjct: 177 LTL 179 Score = 55.2 bits (127), Expect = 4e-08 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +1 Query: 118 GKPVVPAALMNRPTRGERRFAYW 186 GKPVVPAALMNRPTRGERRFAYW Sbjct: 2 GKPVVPAALMNRPTRGERRFAYW 24 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGER 84 >SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 79.0 bits (186), Expect = 3e-15 Identities = 40/50 (80%), Positives = 41/50 (82%) Frame = -3 Query: 502 EQESARGSFQGETPGIFIVLSGFATSDLSVDFCDARQGGGAYGXTPATRP 353 EQESARGS QGET GIFIVLSGFAT+DLSV F DA QGGGAYG T RP Sbjct: 10 EQESARGSRQGETLGIFIVLSGFATTDLSVRFRDACQGGGAYGKTALPRP 59 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 73.7 bits (173), Expect = 1e-13 Identities = 45/88 (51%), Positives = 52/88 (59%) Frame = +2 Query: 347 VKRPRCWRXSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLFRPAAYRIP 526 V+ PR R SIGSAPLTSITK DAQ+ GGETRQDYKDTRR C +L P + P Sbjct: 143 VRGPRQSRFSIGSAPLTSITKSDAQISGGETRQDYKDTRRLHQAGTLCGVLILP--FGFP 200 Query: 527 VRLSPFGKRGAFS*LTL*VSQFGVGRSL 610 V +G+ S + V QF V SL Sbjct: 201 VSFRCYGR---VSLMPTPVDQFRVDISL 225 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYW 61 Score = 45.6 bits (103), Expect = 4e-05 Identities = 21/40 (52%), Positives = 24/40 (60%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGERYQSLKGGNTVIHRIR 293 +C G +PLPRSLTR ARSF CGER GG + R Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLTNGGGDFLEDAR 136 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 64.1 bits (149), Expect = 1e-10 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = +1 Query: 52 LGCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 L C+ S++ I+ V L PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 22 LNCVPSKIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYW 65 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGER 125 >SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 64.1 bits (149), Expect = 1e-10 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 88 CVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 C++ T F VGKPVVPAALMNRPTRGERRFAYW Sbjct: 129 CISFTRIFRVGKPVVPAALMNRPTRGERRFAYW 161 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 197 ICDTGYIPLPRSLTRYARSFDCGER 221 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 62.9 bits (146), Expect = 2e-10 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 76 THINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 T +C+ ++ + VGKPVVPAALMNRPTRGERRFAYW Sbjct: 27 TGFHCILVSFGYSVGKPVVPAALMNRPTRGERRFAYW 63 >SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) Length = 300 Score = 62.9 bits (146), Expect = 2e-10 Identities = 35/65 (53%), Positives = 38/65 (58%), Gaps = 3/65 (4%) Frame = +1 Query: 1 SAHNSTQHTSRKHKV*CLGCLMSE---LTHINCVALTARFPVGKPVVPAALMNRPTRGER 171 S + QH S KHK GC E + + T VGKPVVPAALMNRPTRGER Sbjct: 156 SGEYAVQH-SCKHKAFTEGCKEPEGPKHRYFRRICCTTLLQVGKPVVPAALMNRPTRGER 214 Query: 172 RFAYW 186 RFAYW Sbjct: 215 RFAYW 219 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 255 ICDTGYIPLPRSLTRYARSFDCGER 279 >SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 62.1 bits (144), Expect = 4e-10 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = +1 Query: 58 CLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 C+ S + I+ V L PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 19 CMKSVIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYW 60 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 96 ICDTGYIPLPRSLTRYARSFDCGER 120 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 61.7 bits (143), Expect = 5e-10 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +1 Query: 61 LMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 +M + + VA AR VGKPVVPAALMNRPTRGERRFAYW Sbjct: 208 IMKKSGSVQIVAELAREYVGKPVVPAALMNRPTRGERRFAYW 249 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 285 ICDTGYIPLPRSLTRYARSFDCGER 309 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 61.3 bits (142), Expect = 7e-10 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 94 ALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 A+ P+GKPVVPAALMNRPTRGERRFAYW Sbjct: 173 AINTTLPIGKPVVPAALMNRPTRGERRFAYW 203 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 239 ICDTGYIPLPRSLTRYARSFDCGER 263 >SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 61.3 bits (142), Expect = 7e-10 Identities = 34/57 (59%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = +1 Query: 19 QHTSRKHKV*C-LGCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 +H +RK K+ L M ++ I+ V L PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 102 EHKTRKTKLLSTLPPRMRKIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYW 157 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 193 ICDTGYIPLPRSLTRYARSFDCGER 217 >SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) Length = 753 Score = 61.3 bits (142), Expect = 7e-10 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 106 RFPVGKPVVPAALMNRPTRGERRFAYW 186 R P+GKPVVPAALMNRPTRGERRFAYW Sbjct: 212 RIPIGKPVVPAALMNRPTRGERRFAYW 238 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 274 ICDTGYIPLPRSLTRYARSFDCGER 298 >SB_857| Best HMM Match : Mago_nashi (HMM E-Value=0) Length = 900 Score = 61.3 bits (142), Expect = 7e-10 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 55 GCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 G L + + + +T + VGKPVVPAALMNRPTRGERRFAYW Sbjct: 826 GALPEVIESLPRIKITTQHTVGKPVVPAALMNRPTRGERRFAYW 869 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/40 (67%), Positives = 31/40 (77%), Gaps = 5/40 (12%) Frame = +1 Query: 82 INCVALTARF-----PVGKPVVPAALMNRPTRGERRFAYW 186 + C+A R+ P+GKPVVPAALMNRPTRGERRFAYW Sbjct: 58 VRCIAEGGRYKKNVSPIGKPVVPAALMNRPTRGERRFAYW 97 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGER 157 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 60.5 bits (140), Expect = 1e-09 Identities = 31/44 (70%), Positives = 33/44 (75%) Frame = +1 Query: 55 GCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 G L E+ I+ V L PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 59 GKLHIEIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYW 101 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 137 ICDTGYIPLPRSLTRYARSFDCGER 161 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 60.5 bits (140), Expect = 1e-09 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 109 FPVGKPVVPAALMNRPTRGERRFAYW 186 +P+GKPVVPAALMNRPTRGERRFAYW Sbjct: 71 YPIGKPVVPAALMNRPTRGERRFAYW 96 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGER 156 >SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) Length = 224 Score = 60.5 bits (140), Expect = 1e-09 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +1 Query: 103 ARFPVGKPVVPAALMNRPTRGERRFAYW 186 A F VGKPVVPAALMNRPTRGERRFAYW Sbjct: 106 AEFSVGKPVVPAALMNRPTRGERRFAYW 133 >SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) Length = 168 Score = 60.1 bits (139), Expect = 2e-09 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = +1 Query: 61 LMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 L+S + I+ V L PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 97 LLSLIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYW 137 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 60.1 bits (139), Expect = 2e-09 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 +S++ I+ V L PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 71 VSDIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYW 110 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 146 ICDTGYIPLPRSLTRYARSFDCGER 170 >SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 60.1 bits (139), Expect = 2e-09 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 64 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 +S++ I+ V L PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 111 ISQIKLIDTVDLEGG-PVGKPVVPAALMNRPTRGERRFAYW 150 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 186 ICDTGYIPLPRSLTRYARSFDCGER 210 >SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 60.1 bits (139), Expect = 2e-09 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +1 Query: 76 THINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 T + C R +GKPVVPAALMNRPTRGERRFAYW Sbjct: 90 TCLRCSRFHQRLKLGKPVVPAALMNRPTRGERRFAYW 126 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 162 ICDTGYIPLPRSLTRYARSFDCGER 186 >SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) Length = 145 Score = 60.1 bits (139), Expect = 2e-09 Identities = 31/54 (57%), Positives = 36/54 (66%) Frame = +1 Query: 25 TSRKHKV*CLGCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 TSR+ L L++ ++ T R VGKPVVPAALMNRPTRGERRFAYW Sbjct: 11 TSREFADMQLNPLVAHTILVHARTKTERTLVGKPVVPAALMNRPTRGERRFAYW 64 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 100 ICDTGYIPLPRSLTRYARSFDCGER 124 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 112 PVGKPVVPAALMNRPTRGERRFAYW 136 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 172 ICDTGYIPLPRSLTRYARSFDCGER 196 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYW 61 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGER 121 >SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 134 PVGKPVVPAALMNRPTRGERRFAYW 158 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 236 PVGKPVVPAALMNRPTRGERRFAYW 260 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 296 ICDTGYIPLPRSLTRYARSFDCGER 320 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 56 PVGKPVVPAALMNRPTRGERRFAYW 80 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 61 PVGKPVVPAALMNRPTRGERRFAYW 85 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGER 145 >SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) Length = 187 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 132 PVGKPVVPAALMNRPTRGERRFAYW 156 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 50 PVGKPVVPAALMNRPTRGERRFAYW 74 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 146 PVGKPVVPAALMNRPTRGERRFAYW 170 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 43 PVGKPVVPAALMNRPTRGERRFAYW 67 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 103 ICDTGYIPLPRSLTRYARSFDCGER 127 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 33 PVGKPVVPAALMNRPTRGERRFAYW 57 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGER 117 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 333 PVGKPVVPAALMNRPTRGERRFAYW 357 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 393 ICDTGYIPLPRSLTRYARSFDCGER 417 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 88 PVGKPVVPAALMNRPTRGERRFAYW 112 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 148 ICDTGYIPLPRSLTRYARSFDCGER 172 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 74 PVGKPVVPAALMNRPTRGERRFAYW 98 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGER 158 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 307 PVGKPVVPAALMNRPTRGERRFAYW 331 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 367 ICDTGYIPLPRSLTRYARSFDCGER 391 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 108 PVGKPVVPAALMNRPTRGERRFAYW 132 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 168 ICDTGYIPLPRSLTRYARSFDCGER 192 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 34 PVGKPVVPAALMNRPTRGERRFAYW 58 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGER 118 >SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 468 PVGKPVVPAALMNRPTRGERRFAYW 492 >SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 28 PVGKPVVPAALMNRPTRGERRFAYW 52 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 93 PVGKPVVPAALMNRPTRGERRFAYW 117 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGER 177 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 53 PVGKPVVPAALMNRPTRGERRFAYW 77 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGER 137 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 154 PVGKPVVPAALMNRPTRGERRFAYW 178 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 53 PVGKPVVPAALMNRPTRGERRFAYW 77 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGER 137 >SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) Length = 216 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 161 PVGKPVVPAALMNRPTRGERRFAYW 185 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 57 PVGKPVVPAALMNRPTRGERRFAYW 81 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 117 ICDTGYIPLPRSLTRYARSFDCGER 141 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 79 PVGKPVVPAALMNRPTRGERRFAYW 103 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 139 ICDTGYIPLPRSLTRYARSFDCGER 163 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 56 PVGKPVVPAALMNRPTRGERRFAYW 80 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 116 ICDTGYIPLPRSLTRYARSFDCGER 140 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 59.7 bits (138), Expect = 2e-09 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = +1 Query: 55 GCLMSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 G LM ++ C+ GKPVVPAALMNRPTRGERRFAYW Sbjct: 26 GVLMFVISFSGCLGALRENVFGKPVVPAALMNRPTRGERRFAYW 69 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGER 129 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 17 PVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 56 PVGKPVVPAALMNRPTRGERRFAYW 80 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 39 PVGKPVVPAALMNRPTRGERRFAYW 63 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 99 ICDTGYIPLPRSLTRYARSFDCGER 123 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 290 PVGKPVVPAALMNRPTRGERRFAYW 314 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 350 ICDTGYIPLPRSLTRYARSFDCGER 374 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYW 61 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGER 121 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 78 PVGKPVVPAALMNRPTRGERRFAYW 102 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 138 ICDTGYIPLPRSLTRYARSFDCGER 162 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 24 PVGKPVVPAALMNRPTRGERRFAYW 48 Score = 45.6 bits (103), Expect = 4e-05 Identities = 21/40 (52%), Positives = 24/40 (60%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGERYQSLKGGNTVIHRIR 293 +C G +PLPRSLTR ARSF CGER GG + R Sbjct: 84 ICDTGYIPLPRSLTRYARSFDCGERKWLTNGGGDFLEDAR 123 >SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) Length = 189 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 134 PVGKPVVPAALMNRPTRGERRFAYW 158 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 92 PVGKPVVPAALMNRPTRGERRFAYW 116 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGER 176 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 33 PVGKPVVPAALMNRPTRGERRFAYW 57 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGER 117 >SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 36 PVGKPVVPAALMNRPTRGERRFAYW 60 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 232 PVGKPVVPAALMNRPTRGERRFAYW 256 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 135 PVGKPVVPAALMNRPTRGERRFAYW 159 >SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 28 PVGKPVVPAALMNRPTRGERRFAYW 52 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 744 PVGKPVVPAALMNRPTRGERRFAYW 768 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYW 61 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 134 PVGKPVVPAALMNRPTRGERRFAYW 158 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 194 ICDTGYIPLPRSLTRYARSFDCGER 218 >SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 95 PVGKPVVPAALMNRPTRGERRFAYW 119 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 219 PVGKPVVPAALMNRPTRGERRFAYW 243 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 279 ICDTGYIPLPRSLTRYARSFDCGER 303 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 45 PVGKPVVPAALMNRPTRGERRFAYW 69 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGER 129 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 53 PVGKPVVPAALMNRPTRGERRFAYW 77 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGER 137 >SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) Length = 1728 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 1673 PVGKPVVPAALMNRPTRGERRFAYW 1697 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 95 PVGKPVVPAALMNRPTRGERRFAYW 119 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 155 ICDTGYIPLPRSLTRYARSFDCGER 179 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 63 PVGKPVVPAALMNRPTRGERRFAYW 87 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGER 147 >SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) Length = 409 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 107 PVGKPVVPAALMNRPTRGERRFAYW 131 >SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 93 PVGKPVVPAALMNRPTRGERRFAYW 117 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 32 PVGKPVVPAALMNRPTRGERRFAYW 56 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGER 116 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 41 PVGKPVVPAALMNRPTRGERRFAYW 65 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGER 125 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 935 PVGKPVVPAALMNRPTRGERRFAYW 959 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 995 ICDTGYIPLPRSLTRYARSFDCGER 1019 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 82 PVGKPVVPAALMNRPTRGERRFAYW 106 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 142 ICDTGYIPLPRSLTRYARSFDCGER 166 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 415 PVGKPVVPAALMNRPTRGERRFAYW 439 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 475 ICDTGYIPLPRSLTRYARSFDCGER 499 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 97 PVGKPVVPAALMNRPTRGERRFAYW 121 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 157 ICDTGYIPLPRSLTRYARSFDCGER 181 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 70 PVGKPVVPAALMNRPTRGERRFAYW 94 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGER 154 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 41 PVGKPVVPAALMNRPTRGERRFAYW 65 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGER 125 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 85 PVGKPVVPAALMNRPTRGERRFAYW 109 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 145 ICDTGYIPLPRSLTRYARSFDCGER 169 >SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) Length = 197 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 142 PVGKPVVPAALMNRPTRGERRFAYW 166 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 111 PVGKPVVPAALMNRPTRGERRFAYW 135 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGER 195 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 47 PVGKPVVPAALMNRPTRGERRFAYW 71 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 107 ICDTGYIPLPRSLTRYARSFDCGER 131 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 40 PVGKPVVPAALMNRPTRGERRFAYW 64 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 100 ICDTGYIPLPRSLTRYARSFDCGER 124 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 70 PVGKPVVPAALMNRPTRGERRFAYW 94 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGER 154 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 61 PVGKPVVPAALMNRPTRGERRFAYW 85 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGER 145 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 38 PVGKPVVPAALMNRPTRGERRFAYW 62 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 98 ICDTGYIPLPRSLTRYARSFDCGER 122 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 31 PVGKPVVPAALMNRPTRGERRFAYW 55 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGER 115 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 84 PVGKPVVPAALMNRPTRGERRFAYW 108 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGER 168 >SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 62 PVGKPVVPAALMNRPTRGERRFAYW 86 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 94 PVGKPVVPAALMNRPTRGERRFAYW 118 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 154 ICDTGYIPLPRSLTRYARSFDCGER 178 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 132 PVGKPVVPAALMNRPTRGERRFAYW 156 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C +PLPRSLTR ARSF CGER Sbjct: 192 ICDTRYIPLPRSLTRYARSFDCGER 216 >SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 49 PVGKPVVPAALMNRPTRGERRFAYW 73 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 55 PVGKPVVPAALMNRPTRGERRFAYW 79 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 115 ICDTGYIPLPRSLTRYARSFDCGER 139 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 33 PVGKPVVPAALMNRPTRGERRFAYW 57 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGER 117 >SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 14 PVGKPVVPAALMNRPTRGERRFAYW 38 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/34 (58%), Positives = 26/34 (76%), Gaps = 1/34 (2%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER-YQSLKGGN 272 +C G +PLPRSLTR ARSF CGER + + +GG+ Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLTNRGGD 107 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 35 PVGKPVVPAALMNRPTRGERRFAYW 59 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 95 ICDTGYIPLPRSLTRYARSFDCGER 119 >SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 44 PVGKPVVPAALMNRPTRGERRFAYW 68 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYW 61 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGER 121 >SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) Length = 180 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 75 PVGKPVVPAALMNRPTRGERRFAYW 99 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 135 ICDTGYIPLPRSLTRYARSFDCGER 159 >SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) Length = 138 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 83 PVGKPVVPAALMNRPTRGERRFAYW 107 >SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1263 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 91 VALTARFPVGKPVVPAALMNRPTRGERRFAYW 186 +++ +F VGKPVVPAALMNRPTRGERRFAYW Sbjct: 379 LSMKKKFLVGKPVVPAALMNRPTRGERRFAYW 410 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 446 ICDTGYIPLPRSLTRYARSFDCGER 470 >SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 27 PVGKPVVPAALMNRPTRGERRFAYW 51 >SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 127 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 37 PVGKPVVPAALMNRPTRGERRFAYW 61 Score = 41.9 bits (94), Expect = 4e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 97 ICDTGYIPLPRSLTRYARSFYCGER 121 >SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 48 PVGKPVVPAALMNRPTRGERRFAYW 72 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 108 ICDTGYIPLPRSLTRYARSFDCGER 132 >SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 92 PVGKPVVPAALMNRPTRGERRFAYW 116 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGER 176 >SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 19 PVGKPVVPAALMNRPTRGERRFAYW 43 >SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 32 PVGKPVVPAALMNRPTRGERRFAYW 56 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGER 116 >SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 PVGKPVVPAALMNRPTRGERRFAYW 42 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 78 ICDTGYIPLPRSLTRYARSFDCGER 102 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 71 PVGKPVVPAALMNRPTRGERRFAYW 95 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 131 ICDTGYIPLPRSLTRYARSFDCGER 155 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 99 PVGKPVVPAALMNRPTRGERRFAYW 123 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 159 ICDTGYIPLPRSLTRYARSFDCGER 183 >SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) Length = 435 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 231 PVGKPVVPAALMNRPTRGERRFAYW 255 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 100 PVGKPVVPAALMNRPTRGERRFAYW 124 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 82 PVGKPVVPAALMNRPTRGERRFAYW 106 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 142 ICDTGYIPLPRSLTRYARSFDCGER 166 >SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) Length = 488 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 383 PVGKPVVPAALMNRPTRGERRFAYW 407 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 443 ICDTGYIPLPRSLTRYARSFDCGER 467 >SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 53 PVGKPVVPAALMNRPTRGERRFAYW 77 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGER 137 >SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) Length = 177 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 72 PVGKPVVPAALMNRPTRGERRFAYW 96 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGER 156 >SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 31 PVGKPVVPAALMNRPTRGERRFAYW 55 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGER 115 >SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 32 PVGKPVVPAALMNRPTRGERRFAYW 56 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGER 116 >SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 100 PVGKPVVPAALMNRPTRGERRFAYW 124 >SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 82 PVGKPVVPAALMNRPTRGERRFAYW 106 >SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 86 PVGKPVVPAALMNRPTRGERRFAYW 110 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 146 ICDTGYIPLPRSLTRYARSFDCGER 170 >SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 17 PVGKPVVPAALMNRPTRGERRFAYW 41 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGER 101 >SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 28 PVGKPVVPAALMNRPTRGERRFAYW 52 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 88 ICDTGYIPLPRSLTRYARSFDCGER 112 >SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 77 PVGKPVVPAALMNRPTRGERRFAYW 101 >SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) Length = 558 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 453 PVGKPVVPAALMNRPTRGERRFAYW 477 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 513 ICDTGYIPLPRSLTRYARSFDCGER 537 >SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) Length = 178 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 73 PVGKPVVPAALMNRPTRGERRFAYW 97 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGER 157 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 90 PVGKPVVPAALMNRPTRGERRFAYW 114 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 150 ICDTGYIPLPRSLTRYARSFDCGER 174 >SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 23 PVGKPVVPAALMNRPTRGERRFAYW 47 >SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) Length = 788 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 733 PVGKPVVPAALMNRPTRGERRFAYW 757 >SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 18 PVGKPVVPAALMNRPTRGERRFAYW 42 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 78 ICDTGYIPLPRSLTRYARSFDCGER 102 >SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 32 PVGKPVVPAALMNRPTRGERRFAYW 56 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGER 116 >SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) Length = 178 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 73 PVGKPVVPAALMNRPTRGERRFAYW 97 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGER 157 >SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 59.7 bits (138), Expect = 2e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 112 PVGKPVVPAALMNRPTRGERRFAYW 186 PVGKPVVPAALMNRPTRGERRFAYW Sbjct: 34 PVGKPVVPAALMNRPTRGERRFAYW 58 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 174 VCVLGALPLPRSLTRCARSFGCGER 248 +C G +PLPRSLTR ARSF CGER Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGER 118 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,953,138 Number of Sequences: 59808 Number of extensions: 475664 Number of successful extensions: 2967 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2965 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -