BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1348 (704 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) 103 1e-22 SB_20687| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_57614| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_5733| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_50221| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_39830| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_15102| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_3498| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_36505| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_27609| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_13289| Best HMM Match : DUF543 (HMM E-Value=10) 28 8.5 >SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) Length = 229 Score = 103 bits (247), Expect = 1e-22 Identities = 48/84 (57%), Positives = 54/84 (64%) Frame = +3 Query: 255 DITLHDTYYVVAHFHYVLSXXXXXXXXXXXXN*YPLFTGLSLNSYILKIQFFTIFIGVNI 434 D+ +HDTYYVVAHFHYVLS + TG N KI F+ +FIGVNI Sbjct: 68 DVVMHDTYYVVAHFHYVLSMGAVFAIFAGFYFWFGKITGYCYNELYGKIHFWIMFIGVNI 127 Query: 435 TFFPQHFLGLAGIPRRYSDYPDSY 506 TFFPQHFLGLAG PRRYSD+ D Y Sbjct: 128 TFFPQHFLGLAGFPRRYSDFADGY 151 Score = 93.1 bits (221), Expect = 2e-19 Identities = 44/66 (66%), Positives = 56/66 (84%) Frame = +1 Query: 55 IDIDTRAYFTSATIIIAVPTGIKIFR*LATIHGTQINYNPNIL*RLGFVFLFTVGGLTGV 234 +++DTRAYFT+AT+IIAVPTGIK+F LAT++G I + +L +GFVFLFT+GGLTGV Sbjct: 1 MNVDTRAYFTAATMIIAVPTGIKVFSWLATLYGGAIRLDTPMLWAIGFVFLFTIGGLTGV 60 Query: 235 ILANSS 252 ILANSS Sbjct: 61 ILANSS 66 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 635 SIE*YQNLPPAEHSYNELPIL 697 S+E Q PPA H+YNELP + Sbjct: 199 SLEWVQQSPPALHTYNELPFV 219 >SB_20687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 72.5 bits (170), Expect = 3e-13 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = +3 Query: 366 TGLSLNSYILKIQFFTIFIGVNITFFPQHFLGLAGIPRRYSDYPDSY 506 TG N KI F+ +FIGVNITFFPQHFLGLAG PRRYSD+ D Y Sbjct: 19 TGYCYNELYGKIHFWIMFIGVNITFFPQHFLGLAGFPRRYSDFADGY 65 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 635 SIE*YQNLPPAEHSYNELPIL 697 S+E Q PPA H+YNELP + Sbjct: 113 SLEWVQQSPPALHTYNELPFV 133 >SB_57614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 450 HFLGLAGIPRRYSDYPDSY 506 HFLGLAG PRRYSD+ D Y Sbjct: 1 HFLGLAGFPRRYSDFADGY 19 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 635 SIE*YQNLPPAEHSYNELPIL 697 S+E Q PPA H+YNELP + Sbjct: 67 SLEWVQQSPPALHTYNELPFV 87 >SB_5733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 450 HFLGLAGIPRRYSDYPDSY 506 HFLGLAG PRRYSD+ D Y Sbjct: 1 HFLGLAGFPRRYSDFADGY 19 >SB_50221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 450 HFLGLAGIPRRYSDYPDSY 506 HFLGLAG PRRYSD+ D Y Sbjct: 1 HFLGLAGFPRRYSDFADGY 19 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 635 SIE*YQNLPPAEHSYNELPIL 697 S+E Q PPA H+YNELP + Sbjct: 67 SLEWVQQSPPALHTYNELPFV 87 >SB_39830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 450 HFLGLAGIPRRYSDYPDSY 506 HFLGLAG PRRYSD+ D Y Sbjct: 1 HFLGLAGFPRRYSDFADGY 19 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 635 SIE*YQNLPPAEHSYNELPIL 697 S+E Q PPA H+YNELP + Sbjct: 67 SLEWVQQSPPALHTYNELPFV 87 >SB_15102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 450 HFLGLAGIPRRYSDYPDSY 506 HFLGLAG PRRYSD+ D Y Sbjct: 1 HFLGLAGFPRRYSDFADGY 19 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 635 SIE*YQNLPPAEHSYNELPIL 697 S+E Q PPA H+YNELP + Sbjct: 67 SLEWVQQSPPALHTYNELPFV 87 >SB_3498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 450 HFLGLAGIPRRYSDYPDSY 506 HFLGLAG PRRYSD+ D Y Sbjct: 1 HFLGLAGFPRRYSDFADGY 19 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 635 SIE*YQNLPPAEHSYNELPIL 697 S+E Q PPA H+YNELP + Sbjct: 67 SLEWVQQSPPALHTYNELPFV 87 >SB_36505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = +1 Query: 34 HHIFTVGIDIDTRAYFTSATIIIAVPTGIKIFR*LATIHGTQINYNPNIL 183 HH+ T+ I + T+I PT I + + +H T IN +P ++ Sbjct: 14 HHLHTIIIHLHPTVIHLHPTVIFLHPTVIHLHPTVLNLHPTIINLHPTVI 63 >SB_27609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +2 Query: 353 ISFIYRPFIKFLYTKNSIFYNIYWSK--YNIFSTTFFRFSWNT 475 + FIY + FL +KN F+ YW+ YN F W T Sbjct: 14 VGFIYVAKVVFLLSKNKSFFFEYWTPVVYNAFGQRSPNSRWRT 56 >SB_13289| Best HMM Match : DUF543 (HMM E-Value=10) Length = 319 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 624 ISHHQLNDIKIYHQQNIHIMNYQF 695 I+HHQ + I I H Q+ I+NY + Sbjct: 296 INHHQSSSIIINHHQSSSIINYYY 319 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,441,473 Number of Sequences: 59808 Number of extensions: 201021 Number of successful extensions: 348 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 300 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 347 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -