BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1336 (711 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 24 1.1 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 1.9 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 21 7.5 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 24.2 bits (50), Expect = 1.1 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -1 Query: 270 SAQSGQKCCLNIS 232 S+Q GQK CLN+S Sbjct: 32 SSQKGQKTCLNLS 44 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +2 Query: 461 TATILVYAIGAGITAALAPDLPSNCSSLKYLKCTHSDYEA 580 T +L ++ +A ++ N SSL+YL ++D A Sbjct: 465 TPNLLSLSLAFNSLPTVALEVAGNISSLRYLNLDYNDLSA 504 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.4 bits (43), Expect = 7.5 Identities = 12/40 (30%), Positives = 15/40 (37%) Frame = +1 Query: 400 SITADACTDSAAHKCNYELFNRNNFSIRYWSWNYRGSGTR 519 ++ ADA + K E F NF W Y G R Sbjct: 111 AVAADATKRATMAKSALEFFETYNFDGLDVDWEYPLEGDR 150 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,102 Number of Sequences: 336 Number of extensions: 3609 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18843005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -