BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1336 (711 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_32453| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_35396| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 28 8.6 >SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 64.9 bits (151), Expect = 6e-11 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -1 Query: 117 SWIVARRTSAKAFAKGVFINQERKLEVRRRLDTALVLTV 1 SWI RRT+AKAFAK VFINQERKLE RRR DT LVLT+ Sbjct: 4 SWIYERRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTI 42 >SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 58.0 bits (134), Expect = 7e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 102 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTV 1 RRT+AKAFAK VFINQERKLE RRR DT LVLT+ Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTI 42 >SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 58.0 bits (134), Expect = 7e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 102 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTV 1 RRT+AKAFAK VFINQERKLE RRR DT LVLT+ Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTI 42 >SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 58.0 bits (134), Expect = 7e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 102 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTV 1 RRT+AKAFAK VFINQERKLE RRR DT LVLT+ Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTI 42 >SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 58.0 bits (134), Expect = 7e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 102 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTV 1 RRT+AKAFAK VFINQERKLE RRR DT LVLT+ Sbjct: 11 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTI 44 >SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 56.0 bits (129), Expect = 3e-08 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 99 RTSAKAFAKGVFINQERKLEVRRRLDTALVLTV 1 RT+AKAFAK VFINQERKLE RRR DT LVLT+ Sbjct: 29 RTTAKAFAKNVFINQERKLEDRRRSDTVLVLTI 61 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.0 bits (109), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -1 Query: 99 RTSAKAFAKGVFINQERKLEVRRRLDT 19 RT+AKAFAK VFINQERKLE RRR DT Sbjct: 2 RTTAKAFAKNVFINQERKLEDRRRSDT 28 >SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/35 (65%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = -1 Query: 102 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTV 1 R+T+ ++ AK VFINQERKLE RRR DT LVLT+ Sbjct: 8 RKTNYCESIAKNVFINQERKLEDRRRSDTVLVLTI 42 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -3 Query: 124 VKFLDRRKTNISESICQRCFHQSRTKV 44 VKFLD RKTN ESI + F K+ Sbjct: 2 VKFLDLRKTNYCESIAKNVFINQERKL 28 >SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 1/35 (2%) Frame = -1 Query: 102 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTV 1 R+T+ ++ + VFINQERKLE RRR DT LVLT+ Sbjct: 8 RKTNYCESICQDVFINQERKLEDRRRSDTVLVLTI 42 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 124 VKFLDRRKTNISESICQRCFHQSRTKV 44 VKFLD RKTN ESICQ F K+ Sbjct: 2 VKFLDLRKTNYCESICQDVFINQERKL 28 >SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 1/35 (2%) Frame = -1 Query: 102 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTV 1 R+T+ ++ + FINQERKLE RRR DT LVLT+ Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVLTI 42 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 Query: 121 KFLDRRKTNISESICQRCFHQSRTKV 44 + L RKTN ESICQ CF K+ Sbjct: 3 EILGFRKTNYCESICQECFINQERKL 28 >SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 1/35 (2%) Frame = -1 Query: 102 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTV 1 R+T+ ++ + FINQERKLE RRR DT LVLT+ Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVLTI 42 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -3 Query: 124 VKFLDRRKTNISESICQRCFHQSRTKV 44 VKFLD RKTN ESICQ CF K+ Sbjct: 2 VKFLDLRKTNYCESICQECFINQERKL 28 >SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 1/35 (2%) Frame = -1 Query: 102 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTV 1 R+T+ ++ + FINQERKLE RRR DT LVLT+ Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVLTI 42 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -3 Query: 124 VKFLDRRKTNISESICQRCFHQSRTKV 44 VKFLD RKTN ESICQ CF K+ Sbjct: 2 VKFLDLRKTNYCESICQECFINQERKL 28 >SB_492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -1 Query: 507 AAVIPAPIAYTKIVAVKKL 451 AAVIPAPIAY K+VAVKKL Sbjct: 35 AAVIPAPIAYIKVVAVKKL 53 >SB_51316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -1 Query: 507 AAVIPAPIAYTKIVAVKKL 451 AAVIPAPIAY K+VAVKKL Sbjct: 80 AAVIPAPIAYIKVVAVKKL 98 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -1 Query: 507 AAVIPAPIAYTKIVAVKKL 451 AAVIPAPIAY K+VAVKKL Sbjct: 72 AAVIPAPIAYIKVVAVKKL 90 >SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -1 Query: 507 AAVIPAPIAYTKIVAVKKL 451 AAVIPAPIAY K+VAVKKL Sbjct: 25 AAVIPAPIAYIKVVAVKKL 43 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -1 Query: 507 AAVIPAPIAYTKIVAVKKL 451 AAVIPAPIAY K+VAVKKL Sbjct: 12 AAVIPAPIAYIKVVAVKKL 30 >SB_50608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 35.5 bits (78), Expect = 0.043 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 504 AVIPAPIAYTKIVAVKKL 451 AVIPAPIAY K+VAVKKL Sbjct: 9 AVIPAPIAYIKVVAVKKL 26 >SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +3 Query: 186 KTNKIEPRSYSIIPCTKYSSSIFARFEHSNLFKVKLSAHL 305 K + ++ Y+ + +S F RFEH+N ++KL+ ++ Sbjct: 725 KNHSVDKHDYNNVTPLLFSQERFERFEHNNSLEIKLTVNI 764 >SB_32453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +2 Query: 524 PSN--CSSLKYLKCTHSDYEAS*ESRIVIFRHYL-PVPGVGNLRA 649 PSN CS L YL+C +R+++F H L +G RA Sbjct: 523 PSNLRCSILSYLRCNKPPVTIRWRTRLIVFTHLLVSYRSIGGQRA 567 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 648 PAAFLGCGSVSQAPSPESNPD 710 P + +VSQAPSPESNP+ Sbjct: 100 PIKYWDVVAVSQAPSPESNPN 120 >SB_35396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 53 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -2 Query: 185 QNSEVMINRDNWGHSY-CDVRGEILGSSQDEHQRKHLP 75 Q EV +++ GH Y C GE++ S++D H+ +P Sbjct: 7 QCKEVESSKEILGHPYVCAFAGEVIQSTEDVHKPSWIP 44 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +3 Query: 648 PAAFLGCGSVSQAPSPESNPD 710 P L +VSQAPSPESNP+ Sbjct: 44 PHMLLKGRAVSQAPSPESNPN 64 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 676 FLRLPLRNRTLI 711 FLRLPLRNRTLI Sbjct: 225 FLRLPLRNRTLI 236 >SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 864 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = +1 Query: 472 FSIRYWSWNYR-GSGTRLALQLFLV 543 FSI YW W++R SG+ +++F V Sbjct: 797 FSIEYWRWHHRFYSGSTATIRIFYV 821 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,122,327 Number of Sequences: 59808 Number of extensions: 466685 Number of successful extensions: 1184 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1184 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -