BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1328 (735 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 28 0.26 Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precurso... 27 0.60 L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 26 1.1 AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 25 1.8 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 25 2.4 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 25 2.4 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 4.2 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 4.2 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 5.6 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 23 7.4 Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. 23 9.8 Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. 23 9.8 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 9.8 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 9.8 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 28.3 bits (60), Expect = 0.26 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 392 DQQSPNIAAGVHENRNDEEVGAGDQG 469 DQ+ N G NRN GAGD G Sbjct: 256 DQRGGNYPRGTERNRNGNGYGAGDDG 281 >Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precursor of ANTRYP7 protein. Length = 267 Score = 27.1 bits (57), Expect = 0.60 Identities = 17/61 (27%), Positives = 28/61 (45%) Frame = +2 Query: 308 VRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAGVHENRNDEEVGAGDQGLMFGYA 487 V V+H YDDS+ +DY + L + ++ V DE V AG ++ G+ Sbjct: 110 VARIVEHPNYDDSTIDYDY--ALLELESELTFSDVVQPVALPEQDEAVDAGTMTIVSGWG 167 Query: 488 T 490 + Sbjct: 168 S 168 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 26.2 bits (55), Expect = 1.1 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 138 GEGHPDKMCDQISDAILDAHLNQD 209 G G PD QI AIL+ +N D Sbjct: 11 GNGEPDAFETQIGQAILELEMNSD 34 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 25.4 bits (53), Expect = 1.8 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = -2 Query: 467 PGLLPQLPRHFCSHAPQQQCLVIVGLVRASHCMSCNQSLWTNHHNQ 330 P L L + + P+ QCL+ VR + +L N H Q Sbjct: 147 PSFLTSLTKGIITDCPEVQCLIRCAAVRTGLYTDKDGALLANLHRQ 192 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 25.0 bits (52), Expect = 2.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -2 Query: 401 IVGLVRASHCMSCNQSLWTNHHNQYV*PFRAQLFDNPR 288 +VG+V + MSC Q W H ++ P + L DN R Sbjct: 872 VVGVVCRTPVMSCPQDYWLCHASEECIPVQF-LCDNVR 908 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 25.0 bits (52), Expect = 2.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -2 Query: 401 IVGLVRASHCMSCNQSLWTNHHNQYV*PFRAQLFDNPR 288 +VG+V + MSC Q W H ++ P + L DN R Sbjct: 872 VVGVVCRTPVMSCPQDYWLCHASEECIPVQF-LCDNVR 908 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 24.2 bits (50), Expect = 4.2 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +3 Query: 210 PDAKVACETITKTGMCFCVAKSHPKLTWIIKKLC 311 P+ + C+ + G C KS P+L + K C Sbjct: 486 PEQCLECKNVKYKGKCLDSCKSLPRLYSVDSKTC 519 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 24.2 bits (50), Expect = 4.2 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +2 Query: 146 SSRQNVRPNKRRYSRRAPESGSGRKSC 226 +S + + P++R RR+P SG SC Sbjct: 245 ASIRKIPPSRRNPRRRSPRSGGRWPSC 271 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.8 bits (49), Expect = 5.6 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 140 RGSSRQNVRPNKRRYSRRAPESGSGRK 220 RGS R R R SR SGSG + Sbjct: 1158 RGSRRSRSRSRSRSGSRSRSRSGSGSR 1184 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 23.4 bits (48), Expect = 7.4 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = +2 Query: 530 HTNSIRKLQSSGEMENFGGQDQIQKHRLLANMYLLVVHSPTESSYC 667 H + +RKL++ E+++FG Q+ + R N LL ++ + C Sbjct: 282 HKDILRKLKADPELQSFG--KQVVRIRSTKNGGLLFELKKSDQTEC 325 >Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 308 VRETVKHIGYDDSSKGFDY 364 V V+H YD SS FDY Sbjct: 116 VARVVQHPKYDSSSIDFDY 134 >Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 308 VRETVKHIGYDDSSKGFDY 364 V V+H YD SS FDY Sbjct: 116 VARVVQHPKYDSSSIDFDY 134 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 23.0 bits (47), Expect = 9.8 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 129 ESVGEGHPDKMCDQISDAILDAHLNQDPDA 218 E +GEG PD +C L HL +D D+ Sbjct: 1030 ELLGEGGPDPVCPD----TLQRHLLRDADS 1055 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +2 Query: 95 YGRWISIFVHIGICWRGSSRQNVRPNKRRY 184 Y + + ++VH G+C++ + N R Y Sbjct: 1046 YRKELKVWVHSGLCYKSGTFVNEYDKDRLY 1075 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 860,991 Number of Sequences: 2352 Number of extensions: 20294 Number of successful extensions: 32 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -