BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1321 (713 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family prot... 29 3.1 At1g77240.1 68414.m08996 AMP-binding protein, putative strong si... 29 4.0 At4g30980.1 68417.m04397 basic helix-loop-helix (bHLH) family pr... 28 5.3 At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi... 28 7.1 At3g62370.1 68416.m07006 expressed protein 28 7.1 At5g05360.2 68418.m00577 expressed protein similar to unknown pr... 27 9.3 At5g05360.1 68418.m00578 expressed protein similar to unknown pr... 27 9.3 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 27 9.3 >At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family protein similar to SP|P22418 Fructose-1,6-bisphosphatase, chloroplast precursor (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase) (FBPase) {Spinacia oleracea}; contains Pfam profile PF00316: fructose-1,6-bisphosphatase Length = 404 Score = 29.1 bits (62), Expect = 3.1 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -3 Query: 144 ATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLD 34 A+ + SP+N+ L S SS +D P PL +VS D Sbjct: 105 ASLVASPFNSSLGKLSVNSSSGSDRDAPKPLDIVSND 141 >At1g77240.1 68414.m08996 AMP-binding protein, putative strong similarity to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501 Length = 545 Score = 28.7 bits (61), Expect = 4.0 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -2 Query: 376 VPPQSNSPPGSVLE-PDHAGVLNGDE-RFRHVTTLHAWNET 260 +P SNS P +VL + A + GD H TT+H W+ET Sbjct: 5 LPHASNSCPLTVLGFLERAASVFGDSPSLLHTTTVHTWSET 45 >At4g30980.1 68417.m04397 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 310 Score = 28.3 bits (60), Expect = 5.3 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 277 HAWNETPWPADIIDRAPLP 221 H ++ TPWP+ ++D P P Sbjct: 31 HIFSSTPWPSSVLDDTPPP 49 >At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin like protein A, Arabidopsis thaliana, gb:Q07970 Length = 790 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 238 DRAPLPPNRVSNETMKVVVFQRRSRET 158 +RAPLP V E + + F +R +ET Sbjct: 7 NRAPLPSPNVKKEALSSIPFDKRRKET 33 >At3g62370.1 68416.m07006 expressed protein Length = 361 Score = 27.9 bits (59), Expect = 7.1 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -2 Query: 361 NSPPGSVL--EPDHAGVLNGDERFRHVTTLHAWN 266 N+ PG + P G NG +RF H+ ++AWN Sbjct: 160 NAIPGRLYGGNPIDNGEGNGGDRFGHLVDIYAWN 193 >At5g05360.2 68418.m00577 expressed protein similar to unknown protein (pir||T02500) Length = 153 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -2 Query: 229 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 119 P P+R S V ++ +R+T SHL Y++ V L+ Sbjct: 20 PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56 >At5g05360.1 68418.m00578 expressed protein similar to unknown protein (pir||T02500) Length = 163 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -2 Query: 229 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 119 P P+R S V ++ +R+T SHL Y++ V L+ Sbjct: 20 PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -3 Query: 156 SPTYATPLMSPYNARLESSSTGSSFPADSPK-PVPLA 49 SPT + + SP A ++ + +S P +SPK P P++ Sbjct: 41 SPTKSPAVTSPTTAPAKTPTASASSPVESPKSPAPVS 77 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,228,316 Number of Sequences: 28952 Number of extensions: 352764 Number of successful extensions: 1013 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 974 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1013 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1545769616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -