BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1319 (760 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 5.4 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 5.4 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 5.4 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 5.4 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 5.4 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 5.4 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 5.4 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 7.2 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 21 9.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.5 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 408 RTESCRSRTKRNRHD 364 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 408 RTESCRSRTKRNRHD 364 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 408 RTESCRSRTKRNRHD 364 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 408 RTESCRSRTKRNRHD 364 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 408 RTESCRSRTKRNRHD 364 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 408 RTESCRSRTKRNRHD 364 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 5.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 408 RTESCRSRTKRNRHD 364 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 7.2 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 680 NHSQGNGLGRISGEEDLLSLTLV 748 N G GLG SG +LSL +V Sbjct: 45 NGGGGGGLGIASGLSAMLSLVVV 67 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +2 Query: 467 LKQSIAMALAGVDACDFCPVL 529 L A A+ GVD C PV+ Sbjct: 15 LLNETAKAIIGVDECQATPVI 35 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 9.5 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +3 Query: 477 ALRWPSRVLTHVISAQCSECQREEIQASAGKRR 575 ALRW SR L + E Q + A + R Sbjct: 1632 ALRWRSRYLGDRMQRPMKESQENQQNAETQRER 1664 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 9.5 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +3 Query: 477 ALRWPSRVLTHVISAQCSECQREEIQASAGKRR 575 ALRW SR L + E Q + A + R Sbjct: 1628 ALRWRSRYLGDRMQRPMKESQENQQNAETQRER 1660 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,448 Number of Sequences: 438 Number of extensions: 4897 Number of successful extensions: 14 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -