BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1319 (760 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /... 31 0.83 At1g50260.1 68414.m05635 C2 domain-containing protein low simila... 30 1.5 At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, put... 30 1.9 At1g76965.1 68414.m08961 glycine-rich protein 29 2.5 At5g02040.2 68418.m00125 prenylated rab acceptor (PRA1) family p... 28 5.9 At5g02040.1 68418.m00124 prenylated rab acceptor (PRA1) family p... 28 5.9 At5g22740.1 68418.m02656 glycosyl transferase family 2 protein s... 28 7.7 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 28 7.7 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 28 7.7 >At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory / CAF identical to RNA helicase/RNAseIII CAF protein GB:AAF03534 GI:6102610 from [Arabidopsis thaliana] Length = 1909 Score = 31.1 bits (67), Expect = 0.83 Identities = 13/43 (30%), Positives = 26/43 (60%) Frame = +3 Query: 597 GSQMPRHLISDAHEWINEIPLSYLLSSETTAKGTGLGESAGKK 725 G +P + +SD + INE+ ++ + ++ T K GL ++ GK+ Sbjct: 70 GGGLPNNGVSDTNSQINEVTVTPQVIAKETVKENGLQKNGGKR 112 >At1g50260.1 68414.m05635 C2 domain-containing protein low similarity to CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam profile PF00168: C2 domain Length = 675 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 319 RTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQN 435 R+RVLRPS + + + +S FR S T R A N Sbjct: 37 RSRVLRPSVKISNFRFISCGFRGNSKNLRLTDSSRKAAN 75 >At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 884 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +2 Query: 302 TFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPFNGQLRT 436 T+ T SG R++L+ R+ D HD + PFNG T Sbjct: 179 TYVTQSGSLMMSF-RVYLSNSDASIRYADDVHDRIWSPFNGSSHT 222 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.5 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 195 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 100 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At5g02040.2 68418.m00125 prenylated rab acceptor (PRA1) family protein contains Pfam PF03208: PRA1 family protein Length = 209 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 656 WNLVNPFMRVT-N*MTRHLATLRES*LLPPFTRACLNFFTLTFRALGRNH 510 W + + +RV+ + HLAT+ + L P +A N F FRA+ RN+ Sbjct: 157 WYISSGLLRVSVALLIAHLATILHASLRTPNLKARFNTFREEFRAVWRNY 206 >At5g02040.1 68418.m00124 prenylated rab acceptor (PRA1) family protein contains Pfam PF03208: PRA1 family protein Length = 209 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 656 WNLVNPFMRVT-N*MTRHLATLRES*LLPPFTRACLNFFTLTFRALGRNH 510 W + + +RV+ + HLAT+ + L P +A N F FRA+ RN+ Sbjct: 157 WYISSGLLRVSVALLIAHLATILHASLRTPNLKARFNTFREEFRAVWRNY 206 >At5g22740.1 68418.m02656 glycosyl transferase family 2 protein similar to beta-(1-3)-glucosyl transferase GB:AAC62210 GI:3687658 from [Bradyrhizobium japonicum], cellulose synthase from Agrobacterium tumeficiens [gi:710492] and Agrobacterium radiobacter [gi:710493]; contains Pfam glycosyl transferase, group 2 family protein domain PF00535 Length = 534 Score = 27.9 bits (59), Expect = 7.7 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = +2 Query: 254 ASKTVYI*YDTRENRLTFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPF 418 ASK + I Y RENR+ ++ G+ GL R + V+ C + + D P F Sbjct: 154 ASKGINIRYQIRENRVGYKAGA--LKEGLKRSY--VKHCEYVVIFDADFQPEPDF 204 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -2 Query: 204 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 85 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -2 Query: 204 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 85 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,873,915 Number of Sequences: 28952 Number of extensions: 357832 Number of successful extensions: 897 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 897 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -