BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1311 (520 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 23 2.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 5.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 5.0 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 6.5 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 21 6.5 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 22.6 bits (46), Expect = 2.1 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -3 Query: 467 SFKHLMQFNCWRIQKNYLHYMSII 396 +F HL N R+ KN++ +S+I Sbjct: 248 TFVHLAVLNILRVGKNFVCLLSLI 271 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 5.0 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +3 Query: 408 IMEVILLNSPAVKLHKMFKRRKKVSHINWSFMKTLN 515 + ++LNS V + + +K + H++W F +N Sbjct: 1226 VFTFLMLNSLYVIVIFLLTLKKDLLHLDWPFDPKVN 1261 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 5.0 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +3 Query: 408 IMEVILLNSPAVKLHKMFKRRKKVSHINWSFMKTLN 515 + ++LNS V + + +K + H++W F +N Sbjct: 1226 VFTFLMLNSLYVIVIFLLTLKKDLLHLDWPFDPKVN 1261 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.0 bits (42), Expect = 6.5 Identities = 14/49 (28%), Positives = 22/49 (44%) Frame = -1 Query: 196 YSRNDVHLFVYL*L*NIVLPVYIMFESTIVFFI*KLFA*IRGALVKISN 50 Y R+ L YL + L + I+F +V + ++ G LV I N Sbjct: 126 YKRHKKRLLCYLLARYVALALVILFSEILVIVSEQEWSFSTGLLVMIFN 174 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 21.0 bits (42), Expect = 6.5 Identities = 14/49 (28%), Positives = 22/49 (44%) Frame = -1 Query: 196 YSRNDVHLFVYL*L*NIVLPVYIMFESTIVFFI*KLFA*IRGALVKISN 50 Y R+ L YL + L + I+F +V + ++ G LV I N Sbjct: 144 YKRHKKRLLCYLLARYVALALVILFSEILVIVSEQEWSFSTGLLVMIFN 192 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,289 Number of Sequences: 336 Number of extensions: 2213 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12468463 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -