BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1311 (520 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1259.10 |pgp1||metallopeptidase Pgp1|Schizosaccharomyces pom... 30 0.18 SPBC646.14c |orc5||origin recognition complex subunit Orc5|Schiz... 25 6.8 SPAC2F7.13c |||tryptophan-tRNA ligase |Schizosaccharomyces pombe... 25 6.8 >SPCC1259.10 |pgp1||metallopeptidase Pgp1|Schizosaccharomyces pombe|chr 3|||Manual Length = 412 Score = 30.3 bits (65), Expect = 0.18 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 467 SFKHLMQFNCWRIQKNYLHYMSI 399 S K L QF CW I K +L Y ++ Sbjct: 17 SLKVLQQFRCWNISKTFLSYRTL 39 >SPBC646.14c |orc5||origin recognition complex subunit Orc5|Schizosaccharomyces pombe|chr 2|||Manual Length = 455 Score = 25.0 bits (52), Expect = 6.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -1 Query: 235 VNYLKFIYLIKLIYSRNDVHLFVYL 161 +N FIYL++ S+ D H F+ L Sbjct: 97 INISGFIYLLEQAMSKRDYHTFLVL 121 >SPAC2F7.13c |||tryptophan-tRNA ligase |Schizosaccharomyces pombe|chr 1|||Manual Length = 395 Score = 25.0 bits (52), Expect = 6.8 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 66 NAPRIYANNFYMKKTIVDSNMIYTGNTIFHN 158 NA I A F KKT + N Y G + N Sbjct: 146 NAKDIIAVGFDPKKTFIFMNSTYVGGAFYQN 176 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,872,208 Number of Sequences: 5004 Number of extensions: 34813 Number of successful extensions: 113 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 210309424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -