BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1311 (520 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 23 6.2 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 8.1 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 176 FVCLFIIMKYCVACV 132 FV FIIM +C CV Sbjct: 277 FVLPFIIMAFCYICV 291 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = -1 Query: 214 YLIKLIYSRNDVHLFVYL*L*NIVLPVYIMFESTI 110 +++KLI R V+L V++ L + +Y++F ++ Sbjct: 140 FMLKLIAIRMLVNLVVFVILLLAAITIYVLFNVSL 174 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 443,668 Number of Sequences: 2352 Number of extensions: 8642 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47360208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -