BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1309 (588 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0234 - 26602660-26602728,26602814-26602988,26603077-266031... 42 5e-04 06_01_0356 + 2557127-2557193,2557272-2557315,2557433-2557528,255... 38 0.004 06_03_0740 - 24006485-24006629,24006821-24006864,24006954-240071... 36 0.032 01_06_0465 - 29573972-29574110,29574300-29574343,29574434-295746... 35 0.042 12_02_0992 + 25083397-25083537,25084198-25084228,25084971-250851... 30 1.2 07_03_1756 - 29239137-29239325,29239741-29240259,29240693-292408... 29 3.6 04_04_0466 + 25433678-25434007,25434118-25434176,25434345-254344... 29 3.6 02_02_0456 + 10489544-10491064,10491506-10491632,10491633-10492606 29 3.6 12_01_0109 + 853043-853426,853653-853787,853866-854138 28 4.8 07_01_0436 + 3317334-3317423,3317561-3317908,3317996-3318331,331... 28 6.3 02_03_0106 + 15292869-15296138 28 6.3 09_06_0262 - 21921647-21922796,21922897-21923423 27 8.4 03_03_0107 + 14504065-14504448,14504545-14504922,14506011-145066... 27 8.4 >05_06_0234 - 26602660-26602728,26602814-26602988,26603077-26603120, 26603204-26603381,26603468-26603652,26603737-26603801, 26603985-26604066,26604342-26604434,26605096-26605191, 26605312-26605355,26605467-26605530 Length = 364 Score = 41.5 bits (93), Expect = 5e-04 Identities = 16/36 (44%), Positives = 24/36 (66%) Frame = +2 Query: 143 HAEAMASLPPNVRRRIRALRTLQKEFVDIEAKFYSE 250 H + + SL P VR+R+ LR +Q + D+EAKF+ E Sbjct: 46 HTDVLESLEPKVRKRVEVLREIQSQHDDLEAKFFEE 81 Score = 35.9 bits (79), Expect = 0.024 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = +3 Query: 477 KGYPRLLVQHIRNVSMLSEMMQEHDEPILKCLQDIK 584 KG P + ++N +LSE +QE DE LK L+DIK Sbjct: 129 KGVPEFWLNAMKNHEILSEEIQERDEEALKYLKDIK 164 >06_01_0356 + 2557127-2557193,2557272-2557315,2557433-2557528, 2559259-2559351,2559450-2559540,2559617-2559678, 2559754-2559938,2560022-2560199,2560293-2560336, 2560440-2560635,2560728-2560745,2560955-2561005 Length = 374 Score = 38.3 bits (85), Expect = 0.004 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +2 Query: 143 HAEAMASLPPNVRRRIRALRTLQKEFVDIEAKFYSE 250 H + + +L PNVR+R+ LR +Q + +IE KF+ E Sbjct: 47 HTDVLEALSPNVRKRVEYLREIQGQHDEIELKFFEE 82 Score = 35.9 bits (79), Expect = 0.024 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +3 Query: 468 SQCKGYPRLLVQHIRNVSMLSEMMQEHDEPILKCLQDIK 584 + KG P + ++ +LSE +QE DEP LK L+DIK Sbjct: 129 ADAKGVPDFWLTAMKTNEVLSEEIQERDEPALKYLKDIK 167 >06_03_0740 - 24006485-24006629,24006821-24006864,24006954-24007122, 24007226-24007413,24007572-24007634,24007992-24008084, 24009837-24009932,24010024-24010067,24010184-24010357, 24010764-24010974 Length = 408 Score = 35.5 bits (78), Expect = 0.032 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = +2 Query: 143 HAEAMASLPPNVRRRIRALRTLQKEFVDIEAKFYSE 250 H + + SL P+VR+R+ L +Q + ++E KF+ E Sbjct: 153 HVDVLESLAPSVRKRVDVLMEIQSQHDELEVKFFEE 188 Score = 31.9 bits (69), Expect = 0.39 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = +3 Query: 468 SQCKGYPRLLVQHIRNVSMLSEMMQEHDEPILKCLQDIK 584 S+ KG P + ++N +L+E + E DE LK L+DIK Sbjct: 205 SKEKGVPDFWLNAMKNNEILAEEIHESDEEALKYLKDIK 243 >01_06_0465 - 29573972-29574110,29574300-29574343,29574434-29574602, 29574707-29574894,29575081-29575145,29575257-29575311, 29575502-29575594,29576035-29576130,29576259-29576302, 29576419-29576431 Length = 301 Score = 35.1 bits (77), Expect = 0.042 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +2 Query: 143 HAEAMASLPPNVRRRIRALRTLQKEFVDIEAKFYSEVLHSNAN-MKNFTSLFMK 301 H + + SL P VR+R+ L +Q + ++EAKF E AN K + L+ K Sbjct: 29 HVDVLESLAPVVRKRVDVLIEIQSQHDELEAKFLEEKAALEANYQKLYGPLYSK 82 Score = 31.9 bits (69), Expect = 0.39 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +3 Query: 477 KGYPRLLVQHIRNVSMLSEMMQEHDEPILKCLQDIK 584 KG P ++ ++N +L+E + E DE LK L+DIK Sbjct: 103 KGVPDFWLKAMKNNEILAEEIHESDEEALKYLKDIK 138 >12_02_0992 + 25083397-25083537,25084198-25084228,25084971-25085139, 25085228-25085291,25085408-25085474,25086543-25086586, 25086835-25086922,25087079-25087238,25087659-25087779, 25087859-25087942,25088043-25088162,25088689-25088901, 25088995-25089054,25089144-25089262,25089407-25089465, 25089585-25089919 Length = 624 Score = 30.3 bits (65), Expect = 1.2 Identities = 20/81 (24%), Positives = 41/81 (50%) Frame = +1 Query: 304 RALIVNGTYEPNDDECLNPWRDDTEEEELARAVQNAAITEGEEKKDDKAIEPPMDPNVKG 483 RA+ ++ + E N + ++ + E+E+LARA+Q + + +++ P +P + Sbjct: 185 RAIALSLSEEQNKGKAVDIDYNLEEDEQLARALQESLNADSPPRQNIPVENVPSEP-PRE 243 Query: 484 IPDFWYNISGMSQCSAK*CKN 546 +P + SG C+ CKN Sbjct: 244 LPPILFASSGSRTCAG--CKN 262 >07_03_1756 - 29239137-29239325,29239741-29240259,29240693-29240800, 29240856-29241155,29241730-29241831,29243042-29243209, 29243878-29243991,29244184-29244288,29244372-29244502, 29244794-29244918,29245001-29245172,29245277-29245316, 29245636-29245722,29245803-29245868,29246412-29246510, 29246714-29246836,29247066-29247107,29247195-29247260, 29247362-29247553,29247672-29247737,29248839-29249141 Length = 1038 Score = 28.7 bits (61), Expect = 3.6 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 307 ALIVNGTYEPNDDECLNPWRDDTEEEELARAVQNAAITEGE 429 A IV + EPN + N +D+T E+ A +NAA+T + Sbjct: 685 AAIVTASEEPNGGDSANKLKDETMEDP---ATENAAMTNAD 722 >04_04_0466 + 25433678-25434007,25434118-25434176,25434345-25434426, 25435024-25435122,25435750-25435831,25436759-25436823, 25437241-25438308,25438369-25438446,25438550-25438596, 25438734-25438779,25438871-25438950,25439050-25439166, 25439842-25439923,25440156-25440281,25440415-25440489, 25440743-25440868,25441542-25441646 Length = 888 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = -3 Query: 250 FTVKLGLNVDKLLLKSSQGADSPTNIRG*GCHRFCMKAICDGRYHFIT 107 FT + L+ + LL ++ A+ T + G C++++CDG H +T Sbjct: 177 FTFNISLSRENLLQVAAWDANLVTPHKRMGNAGLCLESLCDGSNHNVT 224 >02_02_0456 + 10489544-10491064,10491506-10491632,10491633-10492606 Length = 873 Score = 28.7 bits (61), Expect = 3.6 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = +2 Query: 137 RLHAEAMASLPPNVRRRIRALRTLQKEFVDIEAKFYSEVLHSNANMKNFTSLF 295 R+H +A+L PN++ + L EF E K L SNAN F F Sbjct: 73 RIHKHCVANLLPNIKDAVYNADDLLDEFRWYEQKV---ALESNANQSPFMDFF 122 >12_01_0109 + 853043-853426,853653-853787,853866-854138 Length = 263 Score = 28.3 bits (60), Expect = 4.8 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -2 Query: 164 GMPSLLHEGDL*WPLSFHYGSRHFSTGVALVHHFXXXXXXLQTP 33 G+P L GD+ + L+F G+ H T VAL F Q+P Sbjct: 129 GVPDLSEHGDV-YDLTFGLGADHPPTAVALRKEFQRIILYQQSP 171 >07_01_0436 + 3317334-3317423,3317561-3317908,3317996-3318331, 3318384-3318442,3318640-3318709,3319259-3319579 Length = 407 Score = 27.9 bits (59), Expect = 6.3 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -2 Query: 266 HSSAVLHCKTWPQCRQTPSEEFSRR--GFADEHSGVGM 159 H+ T+P CR + F RR +HSGVG+ Sbjct: 62 HTMLTFSRATFPSCRMLNQQNFIRRVDSILQQHSGVGV 99 >02_03_0106 + 15292869-15296138 Length = 1089 Score = 27.9 bits (59), Expect = 6.3 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +3 Query: 456 ASNGSQCKGYPRLLVQHIRNVSMLSE--MMQEHDEPILKCLQDIKV 587 AS+ S +P+L + +RN+ L E + E ++ +L CL+ + + Sbjct: 865 ASSSSATASFPKLEILKLRNMKKLEEWSLAVEENQILLPCLKSLHI 910 >09_06_0262 - 21921647-21922796,21922897-21923423 Length = 558 Score = 27.5 bits (58), Expect = 8.4 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +1 Query: 349 CLNPWRDDTEEEELARAVQNAAITEGEEKKDDKAIEPPM 465 CL+PW D E V +AA GE D + E M Sbjct: 300 CLSPWSDHRSSEYYNCNVYDAAKANGEASDDKRRREQGM 338 >03_03_0107 + 14504065-14504448,14504545-14504922,14506011-14506619, 14507110-14507237,14507829-14507832 Length = 500 Score = 27.5 bits (58), Expect = 8.4 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +1 Query: 367 DDTEEEELARAVQNAAITEGEEKKDDKAIEPPMDPNVKGIPDFWYNISGMSQ 522 DD EEEE+ V + + E EE +DD+ EP P V+ + D +++ + + Sbjct: 211 DDDEEEEVMDGVFLSDVEEEEEFEDDEG-EP--KPRVRRLLDEQFDLLALEE 259 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,864,038 Number of Sequences: 37544 Number of extensions: 288844 Number of successful extensions: 892 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 889 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1388195172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -