BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1306 (721 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 29 0.51 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.67 SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst... 26 6.2 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 8.2 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 8.2 SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein glycos... 25 8.2 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 29.5 bits (63), Expect = 0.51 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 164 SGCGRCRVWSMFVRYVRFSELVF*YNAASKMYIF 265 +GCG+ VW +VR+V F E + +Y++ Sbjct: 108 NGCGKSYVWPSYVRFVDFDERYTRFANKYSLYLY 141 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.67 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 347 ARKIRGRPENAGPDPVRNVRRFSRV 273 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1075 Score = 25.8 bits (54), Expect = 6.2 Identities = 11/37 (29%), Positives = 25/37 (67%) Frame = -3 Query: 593 GYLKRVIVTPAVYPRLLEFLHVDIQSTGRNHIASTPA 483 G+++R+ V YP LLE+L++ + S+ + ++++ A Sbjct: 76 GFIERISVILRDYPDLLEYLNIFLPSSYKYLLSNSGA 112 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 8.2 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 201 TNIDQTRHRPHPLPVQTRHAPV 136 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 8.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 89 FPYLHYSID*RLFTLETCCGYGYEPARHL 3 +P+ S+D R+F LE+ GY EP L Sbjct: 159 YPFDLDSLDKRIFKLESKIGYADEPLSEL 187 >SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein glycosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 25.4 bits (53), Expect = 8.2 Identities = 17/63 (26%), Positives = 27/63 (42%) Frame = +3 Query: 249 QKCIYLI*HSRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQNW 428 Q +YL S Y +D RTR++ PSA + + ++ R T V S + Sbjct: 133 QYLVYLTTLYLDSPYTTDLQRTRLILPSAKIDTYTTYNIDGAELPNRVGNTLVYESRETI 192 Query: 429 HGQ 437 G+ Sbjct: 193 TGE 195 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,980,803 Number of Sequences: 5004 Number of extensions: 61539 Number of successful extensions: 147 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 147 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 337208592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -