BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1303 (726 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 4e-15 SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 5e-15 SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 6e-15 SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 76 3e-14 SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 76 3e-14 SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 76 3e-14 SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 76 3e-14 SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 76 3e-14 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 76 3e-14 SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 76 3e-14 SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 76 3e-14 SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 76 3e-14 SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) 76 3e-14 SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) 76 3e-14 SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 76 3e-14 SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 4e-14 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 75 4e-14 SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 4e-14 SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 75 6e-14 SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 6e-14 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 74 1e-13 SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) 74 1e-13 SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) 73 3e-13 SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 68 9e-12 SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 66 2e-11 SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) 63 2e-10 SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 8e-10 SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5) 47 2e-05 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 46 3e-05 SB_11908| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_33090| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_21833| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_48951| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_47505| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_18142| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_57449| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53282| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_59705| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_59162| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_58689| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_58471| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_57504| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_57309| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_57160| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_57088| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_57000| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_56985| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_56864| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_56097| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_55911| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_55353| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_54657| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_54057| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_53941| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_53667| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_53456| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_53229| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_52843| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_51637| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_51120| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_51074| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_51032| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_51007| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_50996| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_50982| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_50953| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_50936| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_50384| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_50220| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49746| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49667| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49638| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49334| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49116| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49113| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_49028| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_48983| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_48970| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_48539| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_48364| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47957| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47808| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47385| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47361| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_47000| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_46654| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_46429| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_46359| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_46213| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_45478| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_45234| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_44852| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_44662| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_43993| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_43758| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_43593| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_43340| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_43144| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_43093| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_42443| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_42383| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_42278| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_42126| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_41977| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40549| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40449| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40443| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40197| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_39975| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_39947| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_39754| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_39490| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_38568| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_38390| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_38374| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_38338| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_38296| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_37924| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_37621| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_37575| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_37514| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_36927| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_36111| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_35639| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_35629| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_35549| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_35413| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_35273| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_35215| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_35079| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34965| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34867| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34812| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34787| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34475| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34273| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34020| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_34019| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_33900| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_33633| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_33363| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_33156| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_33065| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_32699| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_32249| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31827| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31689| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31560| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31456| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31442| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31298| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31283| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31155| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31061| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_30878| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_29626| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_29443| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_28945| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_28854| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_28678| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_28435| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_27744| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_27513| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_27344| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_26541| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_26180| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_26102| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_26045| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_25987| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_25886| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_24955| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_24149| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_24008| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23901| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23701| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23491| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23324| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23308| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23301| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23277| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_22929| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_22512| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_22481| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_22451| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_21947| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_21159| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_21030| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20944| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20880| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20832| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20742| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20690| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20420| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20060| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20036| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_19743| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_19490| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_19448| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_18813| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_18603| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_18478| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_18315| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_17938| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_17616| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_17417| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_17352| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_17230| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_16690| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_16230| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_15921| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_15429| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_15370| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_14040| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_13500| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_12864| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_12842| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_12053| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_12049| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_11704| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_11587| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) 40 0.003 SB_10981| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_10838| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_10043| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9790| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9789| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9564| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9236| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9227| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9169| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_8203| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_8131| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_7699| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_7316| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_7204| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_6994| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_6265| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_6232| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_6109| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_6103| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_5995| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_5987| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_5937| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_5666| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_5533| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_4915| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_4853| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_4538| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_4213| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_4133| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_3630| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_3555| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_3396| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_3272| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_3008| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_2936| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_2741| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_2242| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1859| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1767| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1708| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1630| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1626| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1413| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1202| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_1184| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_620| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_597| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_141| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_59761| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_59213| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_59171| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_58614| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_58352| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_58007| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_57897| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_56954| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_56879| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_56115| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_55873| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_55845| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_55688| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_54804| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_54790| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 >SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 79.0 bits (186), Expect = 4e-15 Identities = 41/81 (50%), Positives = 49/81 (60%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP+F S+ + RTP ++ C Sbjct: 82 MSSPDFQGSSRAHRTPQEVWC 102 >SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 78.6 bits (185), Expect = 5e-15 Identities = 41/81 (50%), Positives = 49/81 (60%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP FS ++ + RTP ++ C Sbjct: 71 MSSPNFSGASRAHRTPQEVWC 91 >SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 25 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 82 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 83 MSSPNFQGSSRAHRTPQEVWC 103 >SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 25 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 82 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 83 MSSPNFQGSSRAHRTPQEVWC 103 >SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 71 MSSPNFQGSSRAHRTPQEVWC 91 >SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 71 MSSPNFQGSSRAHRTPQEVWC 91 >SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 71 MSSPNFQGSSRAHRTPQEVWC 91 >SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V TR L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSTRQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 71 MSSPNFQGSSRAHRTPQEVWC 91 >SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 78.2 bits (184), Expect = 6e-15 Identities = 41/81 (50%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ + RTP ++ C Sbjct: 82 MSSPNFQGSSRAHRTPQEVWC 102 >SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 77.4 bits (182), Expect = 1e-14 Identities = 41/83 (49%), Positives = 48/83 (57%) Frame = -3 Query: 319 RHRPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHL 140 R R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 17 RARVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR-- 74 Query: 139 HVHPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 75 KSMSSPNFQGPSRAHRTPQEVWC 97 >SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 77.0 bits (181), Expect = 1e-14 Identities = 41/81 (50%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 63 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 120 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F S+ RTP ++ C Sbjct: 121 MSSPNFQGSSRVHRTPQEVWC 141 >SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 62 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 119 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 120 MSSPNFQGPSRAHRTPQEVWC 140 >SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 97 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 154 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 155 MSSPNFQGPSRAHRTPQEVWC 175 >SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 25 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 82 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 83 MSSPNFQGPSRAHRTPQEVWC 103 >SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 25 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 82 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 83 MSSPNFQGPSRAHRTPQEVWC 103 >SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 97 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 154 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 155 MSSPNFQGPSRAHRTPQEVWC 175 >SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 25 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 82 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 83 MSSPNFQGPSRAHRTPQEVWC 103 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 97 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 154 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 155 MSSPNFQGPSRAHRTPQEVWC 175 >SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 31 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 88 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 89 MSSPNFQGPSRAHRTPQEVWC 109 >SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 25 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 82 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 83 MSSPNFQGPSRAHRTPQEVWC 103 >SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 25 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 82 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 83 MSSPNFQGPSRAHRTPQEVWC 103 >SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 166 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 223 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 224 MSSPNFQGPSRAHRTPQEVWC 244 >SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 34 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 91 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 92 MSSPNFQGPSRAHRTPQEVWC 112 >SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 62 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 119 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 120 MSSPNFQGPSRAHRTPQEVWC 140 >SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 218 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 136 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 193 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 194 MSSPNFQGPSRAHRTPQEVWC 214 >SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 97 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 154 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 155 MSSPNFQGPSRAHRTPQEVWC 175 >SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 96 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 153 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 154 MSSPNFQGPSRAHRTPQEVWC 174 >SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 97 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 154 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 155 MSSPNFQGPSRAHRTPQEVWC 175 >SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 25 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 82 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 83 MSSPNFQGPSRAHRTPQEVWC 103 >SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 45 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 102 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 103 MSSPNFQGPSRAHRTPQEVWC 123 >SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 135 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 192 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 193 MSSPNFQGPSRAHRTPQEVWC 213 >SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 31 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 88 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 89 MSSPNFQGPSRAHRTPQEVWC 109 >SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 135 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 192 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 193 MSSPNFQGPSRAHRTPQEVWC 213 >SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) Length = 204 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 122 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 179 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 180 MSSPNFQGPSRAHRTPQEVWC 200 >SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 62 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 119 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 120 MSSPNFQGPSRAHRTPQEVWC 140 >SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 63 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 120 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 121 MSSPNFQGPSRAHRTPQEVWC 141 >SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 62 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 119 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 120 MSSPNFQGPSRAHRTPQEVWC 140 >SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 71 MSSPNFQGPSRAHRTPQEVWC 91 >SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) Length = 106 Score = 75.8 bits (178), Expect = 3e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLHTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 75.8 bits (178), Expect = 3e-14 Identities = 36/69 (52%), Positives = 45/69 (65%) Frame = -3 Query: 277 PVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 98 P LRANP+P++ FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 37 PTLRANPFPEVTDLFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRA 94 Query: 97 IRTPPQMRC 71 RTP ++ C Sbjct: 95 HRTPQEVWC 103 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 75.8 bits (178), Expect = 3e-14 Identities = 41/83 (49%), Positives = 48/83 (57%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 176 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 233 Query: 133 HPSPEFSRSAESIRTPPQMRCSS 65 SP F S+ + RTP + S+ Sbjct: 234 MSSPNFQGSSRAHRTPQEALTSA 256 >SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 75.4 bits (177), Expect = 4e-14 Identities = 40/81 (49%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 62 RVHWLQVLARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 119 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 120 MSSPNFQGPSRAHRTPQEVWC 140 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 75.4 bits (177), Expect = 4e-14 Identities = 40/78 (51%), Positives = 46/78 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQ 80 SP F S+ + RTP + Sbjct: 82 MSSPNFQGSSRAHRTPQE 99 >SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 75.4 bits (177), Expect = 4e-14 Identities = 40/81 (49%), Positives = 46/81 (56%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYNRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) Length = 237 Score = 74.9 bits (176), Expect = 6e-14 Identities = 42/88 (47%), Positives = 49/88 (55%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRCSSRSEPY 50 SP F + + RTP + + R PY Sbjct: 82 MSSPNFQGPSRAHRTPQE---TGRMRPY 106 >SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 74.9 bits (176), Expect = 6e-14 Identities = 39/81 (48%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH +I+ RL TLETCCGY Y+ R Sbjct: 37 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCAINQRLLTLETCCGYEYDRTR--KS 94 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 95 MSSPNFQGPSRAHRTPQEVWC 115 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 74.5 bits (175), Expect = 8e-14 Identities = 40/80 (50%), Positives = 46/80 (57%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 62 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 119 Query: 133 HPSPEFSRSAESIRTPPQMR 74 SP F + + RTP + R Sbjct: 120 MSSPNFQGPSRAHRTPQENR 139 >SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 74.5 bits (175), Expect = 8e-14 Identities = 39/81 (48%), Positives = 46/81 (56%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI F DFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFVDFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 74.5 bits (175), Expect = 8e-14 Identities = 39/81 (48%), Positives = 46/81 (56%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPFEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVCC 102 >SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 74.1 bits (174), Expect = 1e-13 Identities = 39/81 (48%), Positives = 47/81 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 P+ F + + RTP ++ C Sbjct: 84 FPN--FQGPSRAHRTPQEVWC 102 >SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 39/81 (48%), Positives = 46/81 (56%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL LETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLKLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 402 Score = 73.7 bits (173), Expect = 1e-13 Identities = 40/83 (48%), Positives = 47/83 (56%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 163 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 220 Query: 133 HPSPEFSRSAESIRTPPQMRCSS 65 SP F + + RTP + S+ Sbjct: 221 MSSPNFQGPSRAHRTPQEALTSA 243 >SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 73.7 bits (173), Expect = 1e-13 Identities = 38/75 (50%), Positives = 44/75 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMS 83 Query: 133 HPSPEFSRSAESIRT 89 P+ EF + S R+ Sbjct: 84 SPNIEFLQPGGSTRS 98 >SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 73.7 bits (173), Expect = 1e-13 Identities = 40/72 (55%), Positives = 43/72 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAES 98 PEFSR ES Sbjct: 82 MSFPEFSRVVES 93 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 73.7 bits (173), Expect = 1e-13 Identities = 39/79 (49%), Positives = 46/79 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQM 77 SP F + + RTP ++ Sbjct: 71 MSSPNFQGPSRAHRTPQEV 89 >SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) Length = 309 Score = 73.7 bits (173), Expect = 1e-13 Identities = 39/79 (49%), Positives = 46/79 (58%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQM 77 SP F + + RTP ++ Sbjct: 82 MSSPNFQGPSRAHRTPQEV 100 >SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 73.3 bits (172), Expect = 2e-13 Identities = 39/78 (50%), Positives = 45/78 (57%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQ 80 SP F + + RTP + Sbjct: 82 MSSPNFQGPSRAHRTPQE 99 >SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 73.3 bits (172), Expect = 2e-13 Identities = 39/78 (50%), Positives = 45/78 (57%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQ 80 SP F + + RTP + Sbjct: 82 MSSPNFQGPSRAHRTPQE 99 >SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 72.9 bits (171), Expect = 2e-13 Identities = 40/81 (49%), Positives = 48/81 (59%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L+ +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTN-LKPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 80 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 81 MSSPNFQGPSRAHRTPQEVWC 101 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 72.9 bits (171), Expect = 2e-13 Identities = 35/62 (56%), Positives = 42/62 (67%) Frame = -3 Query: 256 YPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQM 77 +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RTP ++ Sbjct: 95 FPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEV 152 Query: 76 RC 71 C Sbjct: 153 WC 154 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 72.5 bits (170), Expect = 3e-13 Identities = 40/80 (50%), Positives = 45/80 (56%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 13 RVHWLQVSARQTQPLEPILLPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 70 Query: 133 HPSPEFSRSAESIRTPPQMR 74 SP F + + RTP + R Sbjct: 71 MSSPNFQGPSRAHRTPQEDR 90 >SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) Length = 321 Score = 72.5 bits (170), Expect = 3e-13 Identities = 36/69 (52%), Positives = 43/69 (62%) Frame = -3 Query: 277 PVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 98 P L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 251 PTLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRA 308 Query: 97 IRTPPQMRC 71 RTP ++ C Sbjct: 309 HRTPQEVWC 317 >SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 71.3 bits (167), Expect = 7e-13 Identities = 37/73 (50%), Positives = 45/73 (61%), Gaps = 1/73 (1%) Frame = -3 Query: 286 RHAPVLRANPYPK-LRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSR 110 R L ANP+ + LRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F Sbjct: 4 RQTQPLEANPFSRRLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQG 61 Query: 109 SAESIRTPPQMRC 71 + + RTP ++ C Sbjct: 62 PSRAHRTPQEVWC 74 >SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 70.5 bits (165), Expect = 1e-12 Identities = 38/81 (46%), Positives = 45/81 (55%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R + KLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARRTQSKEPILFSKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F + + RTP ++ C Sbjct: 82 MSSPNFQGPSRAHRTPQEVWC 102 >SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 69.7 bits (163), Expect = 2e-12 Identities = 38/76 (50%), Positives = 43/76 (56%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L + KLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARRTQSLEPILFSKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTP 86 SP F + + RTP Sbjct: 82 MSSPNFQGPSRAHRTP 97 >SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 69.3 bits (162), Expect = 3e-12 Identities = 40/81 (49%), Positives = 44/81 (54%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRTPPQMRC 71 SP F E RT +C Sbjct: 82 MSSPNFQGRRE--RTGHHKKC 100 >SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 68.9 bits (161), Expect = 4e-12 Identities = 37/75 (49%), Positives = 42/75 (56%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 134 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 81 Query: 133 HPSPEFSRSAESIRT 89 SP F ++ T Sbjct: 82 MSSPNFQGRQDATET 96 >SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 68.5 bits (160), Expect = 5e-12 Identities = 33/56 (58%), Positives = 36/56 (64%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPAR 146 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR 79 >SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 68.5 bits (160), Expect = 5e-12 Identities = 33/56 (58%), Positives = 36/56 (64%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPAR 146 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR 79 >SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 68.1 bits (159), Expect = 7e-12 Identities = 33/56 (58%), Positives = 37/56 (66%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPAR 146 R H L V +R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 24 RVHWLQVSSRQTQSLDPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR 79 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 67.7 bits (158), Expect = 9e-12 Identities = 33/56 (58%), Positives = 36/56 (64%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPAR 146 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 719 RVHWLQVLARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR 774 >SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 67.3 bits (157), Expect = 1e-11 Identities = 32/53 (60%), Positives = 35/53 (66%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYE 155 R H L V R L +PKLRI FADFPYLH SI+ RL TLETCCGY Y+ Sbjct: 24 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) Length = 276 Score = 66.5 bits (155), Expect = 2e-11 Identities = 33/72 (45%), Positives = 42/72 (58%) Frame = -3 Query: 277 PVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 98 P LRANP+P++ F PYLH SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 141 PTLRANPFPEVTDLFCRLPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRA 198 Query: 97 IRTPPQMRCSSR 62 RTP ++ R Sbjct: 199 HRTPQEICTGGR 210 >SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 65.3 bits (152), Expect = 5e-11 Identities = 32/69 (46%), Positives = 41/69 (59%) Frame = -3 Query: 277 PVLRANPYPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 98 P LRANP+P++ F P LH SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 37 PTLRANPFPEVTDLFCRLPLLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRA 94 Query: 97 IRTPPQMRC 71 RTP ++ C Sbjct: 95 HRTPQEVWC 103 >SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 64.9 bits (151), Expect = 6e-11 Identities = 32/59 (54%), Positives = 38/59 (64%) Frame = -3 Query: 247 LRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 71 LRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 57 >SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 64.9 bits (151), Expect = 6e-11 Identities = 32/59 (54%), Positives = 38/59 (64%) Frame = -3 Query: 247 LRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 71 LRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 57 >SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 64.9 bits (151), Expect = 6e-11 Identities = 32/59 (54%), Positives = 38/59 (64%) Frame = -3 Query: 247 LRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 71 LRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 2 LRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 58 >SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 64.9 bits (151), Expect = 6e-11 Identities = 32/59 (54%), Positives = 38/59 (64%) Frame = -3 Query: 247 LRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 71 LRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 57 >SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) Length = 521 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 661 HSEHWAEITLRQHPRGPSQCFVLIRQSDSPCPCQF 557 ++EHWAEITLRQH PSQCFVLI+QSDSP CQF Sbjct: 48 NNEHWAEITLRQHRFRPSQCFVLIKQSDSPSHCQF 82 >SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 61.7 bits (143), Expect = 6e-10 Identities = 30/57 (52%), Positives = 36/57 (63%) Frame = -3 Query: 241 IQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 71 I FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 4 IYFADFPYLHVSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 58 >SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 61.3 bits (142), Expect = 8e-10 Identities = 30/57 (52%), Positives = 36/57 (63%) Frame = -3 Query: 241 IQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 71 I FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RTP ++ C Sbjct: 10 IYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWC 64 >SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 60.1 bits (139), Expect = 2e-09 Identities = 30/50 (60%), Positives = 33/50 (66%) Frame = -3 Query: 247 LRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 98 LRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + ES Sbjct: 1 LRIYFADFPYLHVSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGAVES 48 >SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 56.4 bits (130), Expect = 2e-08 Identities = 35/75 (46%), Positives = 44/75 (58%), Gaps = 3/75 (4%) Frame = -2 Query: 251 EVTDPICRLPLPTLFYRLEALHLGDLLRIWVRTGATSPRTSLT*IFKVRR---EYPDTAA 81 EVTD CRLPLPTLFY+ EA HLGDLLR+ VR P T + + R PDT Sbjct: 86 EVTDLFCRLPLPTLFYQPEAAHLGDLLRLLVR-----PDTKINVFPEFSRAVESAPDTTR 140 Query: 80 NAVLFAFRTISPFYR 36 + V+ +R ++P R Sbjct: 141 SVVV--YRALNPISR 153 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 51.6 bits (118), Expect = 6e-07 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = -2 Query: 251 EVTDPICRLPLPTLFYRLEALHLGDLLR 168 EVTD CRLPLPTLFY+ EA HLGDLLR Sbjct: 46 EVTDLFCRLPLPTLFYQPEAAHLGDLLR 73 >SB_32812| Best HMM Match : CfAFP (HMM E-Value=9.5) Length = 167 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 649 SALNVNVKKFKQARVNGGSNYDSL 720 +ALNV VKKF QARVNGGSNYDSL Sbjct: 28 AALNVKVKKFNQARVNGGSNYDSL 51 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 46.0 bits (104), Expect = 3e-05 Identities = 26/50 (52%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = -3 Query: 313 RPHPLPVQTRHAPVLRANPYPKLRIQFADFPYLHYSID*RLF--TLETCC 170 R H L V R L +PKLRI FADFPYLH SI+ RL LE+ C Sbjct: 37 RVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLGDPLESTC 86 >SB_11908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +1 Query: 652 ALNVNVKKFKQARVNGGSNYDSL 720 ALNV VKKF QARVNG SNYDSL Sbjct: 2 ALNVKVKKFNQARVNGWSNYDSL 24 >SB_33090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 41.5 bits (93), Expect = 7e-04 Identities = 20/42 (47%), Positives = 25/42 (59%) Frame = -3 Query: 196 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 71 RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 40 RLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 79 >SB_21833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 41.5 bits (93), Expect = 7e-04 Identities = 20/42 (47%), Positives = 25/42 (59%) Frame = -3 Query: 196 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRC 71 RL TLETCCGY Y+ R SP F S+ + RTP ++ C Sbjct: 40 RLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRTPQEVWC 79 >SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 41.1 bits (92), Expect = 9e-04 Identities = 24/53 (45%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = -3 Query: 196 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSS--RSEPYLP 44 RL TLETCCGY Y+ R PEFSR+ RT +C + +PYLP Sbjct: 1 RLLTLETCCGYEYDRTR--KSMSFPEFSRAVRE-RTGHHKKCGALPSIKPYLP 50 >SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/50 (42%), Positives = 27/50 (54%) Frame = -3 Query: 196 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSRSEPYL 47 RL TLETCCGY Y+ R SP+F + + RTP + +PYL Sbjct: 1 RLLTLETCCGYEYDRTR--KSMSSPKFQGPSRAHRTPQKCGALPSIKPYL 48 >SB_48951| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/33 (60%), Positives = 22/33 (66%) Frame = -3 Query: 196 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 98 RL TLETCCGY Y+ R SPEFSR+ ES Sbjct: 1 RLLTLETCCGYEYDRTR--KSMSSPEFSRAVES 31 >SB_47505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = -3 Query: 196 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSRS 59 RL TLETCCGY Y+ R SP F + + RTP ++ C R+ Sbjct: 1 RLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRTPQEVWCFYRA 44 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,011,948 Number of Sequences: 59808 Number of extensions: 530438 Number of successful extensions: 3085 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2148 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2353 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -