BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1303 (726 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 23 3.9 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 23 3.9 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 22 6.8 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 9.0 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 9.0 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 9.0 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 9.0 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 3.9 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 299 KRMRPVPGLVDVRALCSF*RVSILI*CGLKNCI 397 K +RPV DV +C ++S LI LKN I Sbjct: 42 KLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQI 74 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 22.6 bits (46), Expect = 3.9 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 299 KRMRPVPGLVDVRALCSF*RVSILI*CGLKNCI 397 K +RPV DV +C ++S LI LKN I Sbjct: 42 KLVRPVVNTSDVLRVCIKLKLSQLIDVNLKNQI 74 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.8 bits (44), Expect = 6.8 Identities = 20/78 (25%), Positives = 32/78 (41%) Frame = -3 Query: 481 RKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAALY*NTNSLKRT*RTNIDQTRHRPHP 302 RK R + D R R S+ I ++ ++ N N+ K+ NI+ P P Sbjct: 57 RKYRETSKERSRD--RKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNINYIEQIPVP 114 Query: 301 LPVQTRHAPVLRANPYPK 248 +P+ PV N P+ Sbjct: 115 VPIP---VPVYYGNFLPR 129 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 9.0 Identities = 17/63 (26%), Positives = 27/63 (42%) Frame = -3 Query: 481 RKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAALY*NTNSLKRT*RTNIDQTRHRPHP 302 RK R + D R R S+ I ++ ++ N N+ K+ NI+ P P Sbjct: 57 RKYRETSKERSRD--RKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNINYIEQIPVP 114 Query: 301 LPV 293 +PV Sbjct: 115 VPV 117 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 9.0 Identities = 17/63 (26%), Positives = 27/63 (42%) Frame = -3 Query: 481 RKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAALY*NTNSLKRT*RTNIDQTRHRPHP 302 RK R + D R R S+ I ++ ++ N N+ K+ NI+ P P Sbjct: 57 RKYRETSKERSRD--RKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNINYIEQIPVP 114 Query: 301 LPV 293 +PV Sbjct: 115 VPV 117 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 9.0 Identities = 17/63 (26%), Positives = 27/63 (42%) Frame = -3 Query: 481 RKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAALY*NTNSLKRT*RTNIDQTRHRPHP 302 RK R + D R R S+ I ++ ++ N N+ K+ NI+ P P Sbjct: 57 RKYRETSKERSRD--RKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNINYIEQIPVP 114 Query: 301 LPV 293 +PV Sbjct: 115 VPV 117 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.4 bits (43), Expect = 9.0 Identities = 17/63 (26%), Positives = 27/63 (42%) Frame = -3 Query: 481 RKIRGRPENAGPDPVRNVRRFSRVSY*IYTVFEAALY*NTNSLKRT*RTNIDQTRHRPHP 302 RK R + D R R S+ I ++ ++ N N+ K+ NI+ P P Sbjct: 290 RKYRETSKERSRD--RKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNINYIEQIPVP 347 Query: 301 LPV 293 +PV Sbjct: 348 VPV 350 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,920 Number of Sequences: 438 Number of extensions: 4865 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -