BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1301 (766 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC576.13 |swc5||chromatin remodeling complex subunit Swc5|Schi... 28 1.7 SPBC713.06 |adl1|lig3|DNA ligase |Schizosaccharomyces pombe|chr ... 27 3.9 SPAC56F8.08 |mud1|ucp1, ddi1|UBA domain protein Mud1|Schizosacch... 27 3.9 >SPCC576.13 |swc5||chromatin remodeling complex subunit Swc5|Schizosaccharomyces pombe|chr 3|||Manual Length = 215 Score = 27.9 bits (59), Expect = 1.7 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = -3 Query: 758 KKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKD 654 +KS + ++ K+++ NK+N +E A Q W + K+ Sbjct: 141 RKSPLDSSSAQKVLKKNKLNTLEQAQQNWSKYIKE 175 >SPBC713.06 |adl1|lig3|DNA ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 774 Score = 26.6 bits (56), Expect = 3.9 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 758 KKSEVITNVVNKLIRNNKMNCMEYAYQLWLQ 666 K+ +T+ NKL+ ++ + +YAY L LQ Sbjct: 35 KREAQLTDTPNKLLTDHDQSASDYAYALKLQ 65 >SPAC56F8.08 |mud1|ucp1, ddi1|UBA domain protein Mud1|Schizosaccharomyces pombe|chr 1|||Manual Length = 332 Score = 26.6 bits (56), Expect = 3.9 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = -3 Query: 293 FMYNR---EYNEALVLLGQPTPGVTAWRSDTVAAWSEVPSST 177 F+ NR E+ + +L P T W+S + ++PSST Sbjct: 18 FLLNRIRTEFPQLAAVLNDPNAFATTWQSINASQLLQIPSST 59 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,160,353 Number of Sequences: 5004 Number of extensions: 64925 Number of successful extensions: 181 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 174 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 181 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 367316502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -