BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1301 (766 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39580.1 68415.m04855 expressed protein 28 5.9 At2g02580.1 68415.m00198 cytochrome P450 family protein 28 7.8 >At2g39580.1 68415.m04855 expressed protein Length = 1567 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 362 WPRRPCGYGSGLFELPTSNT 421 W R PC SGL+ +P S T Sbjct: 392 WKRLPCSNNSGLYNIPGSTT 411 >At2g02580.1 68415.m00198 cytochrome P450 family protein Length = 500 Score = 27.9 bits (59), Expect = 7.8 Identities = 16/58 (27%), Positives = 27/58 (46%) Frame = -3 Query: 494 VSWKFVPLWENNKVYFKIVNTQRNQYLTLAVQTTPNHNHMAYGANSVEGFKAQWTLQP 321 ++W L N +V K+ + RNQ + +V T + +H+ Y + K W L P Sbjct: 310 MTWAMAELIRNPRVMKKVQSEIRNQMINKSVITLDDIDHLPYLKMVI---KETWRLHP 364 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,328,349 Number of Sequences: 28952 Number of extensions: 336459 Number of successful extensions: 919 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 899 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 919 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1712086600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -