BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1295 (603 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) 28 6.7 SB_14655| Best HMM Match : Ketoacyl-synt_C (HMM E-Value=0) 27 8.8 >SB_25361| Best HMM Match : Cadherin (HMM E-Value=0) Length = 4833 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 126 VVAKNIFLNRIKPSQATHPYFVV 58 V+AKN+F N + PS H VV Sbjct: 3213 VIAKNLFQNSVTPSSVAHATIVV 3235 >SB_14655| Best HMM Match : Ketoacyl-synt_C (HMM E-Value=0) Length = 2232 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = -1 Query: 192 LHSIYFKCSFQVFIMYSSFFKVVVAKNIFLNRIKPSQAT 76 L+ + F CSF VFI+ S + + V++ ++R P + T Sbjct: 489 LNQLTFVCSFPVFIL-SFLWSISVSQVFLISRFGPGRTT 526 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,985,016 Number of Sequences: 59808 Number of extensions: 352675 Number of successful extensions: 524 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 523 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -