BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1295 (603 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132858-15|CAB60482.3| 300|Caenorhabditis elegans Hypothetical... 30 1.5 U13646-1|AAC24418.2| 2585|Caenorhabditis elegans Hypothetical pr... 28 5.9 >AL132858-15|CAB60482.3| 300|Caenorhabditis elegans Hypothetical protein Y113G7A.10 protein. Length = 300 Score = 29.9 bits (64), Expect = 1.5 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 310 HGRISSLWSGRESCFAFPLH*SVLPTSILHCF 405 +G S+ W G S FA PL + S HCF Sbjct: 71 NGTHSATWQGHVSSFALPLECHINSKSYTHCF 102 >U13646-1|AAC24418.2| 2585|Caenorhabditis elegans Hypothetical protein ZK783.1 protein. Length = 2585 Score = 27.9 bits (59), Expect = 5.9 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +1 Query: 256 FEFHIIFVKNKCTRTD-HIHGRISSLWSGRESCFAFP-LH*SVLP 384 F+ + ++ TD HIH +SSL G++ CF P +H V P Sbjct: 38 FDTSTVICQHSSDPTDLHIHN-MSSLCDGKQDCFVNPAMHDEVFP 81 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,934,597 Number of Sequences: 27780 Number of extensions: 282883 Number of successful extensions: 528 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 528 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1289949676 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -