BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1289 (706 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosa... 28 1.5 SPAC1F3.07c |rsc58||RSC complex subunit Rsc58|Schizosaccharomyce... 27 3.5 SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 25 8.0 SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst... 25 8.0 >SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosaccharomyces pombe|chr 1|||Manual Length = 317 Score = 27.9 bits (59), Expect = 1.5 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -2 Query: 168 YICQRITQVS*GQL--SEDRNLAWSKRAKAGLIQMFSTHRDCESTAY 34 Y+C + +S G L SED ++ W K GLI+ F + E+ Y Sbjct: 127 YVCPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQFIKDVNWENLDY 173 >SPAC1F3.07c |rsc58||RSC complex subunit Rsc58|Schizosaccharomyces pombe|chr 1|||Manual Length = 403 Score = 26.6 bits (56), Expect = 3.5 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 3/67 (4%) Frame = +1 Query: 16 LYTKGSIGRAFAVPMRTEHLD-QASFCPFAPREVSVLAELALGHLR-YSLTDV-PPQSNS 186 L+ GS G F+ RT LD + + V++L ++ + + Y+L + PP + Sbjct: 125 LFMVGSAGPLFSSTARTSRLDSRLPDGGIIAKPVALLPTPSVANSQEYTLDKLSPPSTAK 184 Query: 187 PPGSVLE 207 PP SV+E Sbjct: 185 PPASVIE 191 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 25.4 bits (53), Expect = 8.0 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +3 Query: 51 SPYAY*TSGSSQLLPFCSTRGF 116 SPYA+ T S+ L PF STR + Sbjct: 1211 SPYAFSTVYSNCLNPFISTRSY 1232 >SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1075 Score = 25.4 bits (53), Expect = 8.0 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +1 Query: 577 GYLKRVIVTPAVYPRLLEFLHVDIQST 657 G+++R+ V YP LLE+L++ + S+ Sbjct: 76 GFIERISVILRDYPDLLEYLNIFLPSS 102 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,958,848 Number of Sequences: 5004 Number of extensions: 61503 Number of successful extensions: 171 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 171 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -