BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1284 (669 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 2.0 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 23 3.5 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 23 3.5 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 22 6.1 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 8.0 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 8.0 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 21 8.0 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 21 8.0 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 21 8.0 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 21 8.0 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 8.0 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 23.4 bits (48), Expect = 2.0 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 312 GWDGLGLISYCLVIYYQNLKSYNAGILTALSNRI 413 G +GLG+ + +Y Q+L + LTALS + Sbjct: 3 GEEGLGVTTGQPNLYKQDLSKLDVSKLTALSREV 36 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 22.6 bits (46), Expect = 3.5 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -1 Query: 507 HNHSS*NQNKKYNFNFHN 454 HN+++ N N N+N++N Sbjct: 91 HNNNNYNNNNYNNYNYNN 108 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 507 HNHSS*NQNKKYNFNFHN 454 +N++ N N KYN+N +N Sbjct: 320 NNYNYNNNNYKYNYNNYN 337 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 507 HNHSS*NQNKKYNFNFHN 454 +N+ N N KYN+N +N Sbjct: 93 NNNYKYNYNNKYNYNNNN 110 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 504 NHSS*NQNKKYNFNFHN 454 N++ N N KYN+N +N Sbjct: 86 NNTIHNNNYKYNYNNNN 102 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 504 NHSS*NQNKKYNFNFHN 454 N++ N N KYN+N +N Sbjct: 86 NNTIHNNNYKYNYNNNN 102 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 504 NHSS*NQNKKYNFNFHN 454 N++ N N KYN+N +N Sbjct: 87 NNTIHNNNYKYNYNNNN 103 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 504 NHSS*NQNKKYNFNFHN 454 N++ N N KYN+N +N Sbjct: 87 NNTIHNNNYKYNYNNNN 103 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 504 NHSS*NQNKKYNFNFHN 454 N++ N N KYN+N +N Sbjct: 87 NNTIHNNNYKYNYNNNN 103 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 504 NHSS*NQNKKYNFNFHN 454 N++ N N KYN+N +N Sbjct: 87 NNTIHNNNYKYNYNNNN 103 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.4 bits (43), Expect = 8.0 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 590 AIAAPTPVSALVHSSTLVTAG 652 A A PTP S V S+ TAG Sbjct: 48 AAATPTPPSVPVGSAVAGTAG 68 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,640 Number of Sequences: 438 Number of extensions: 1146 Number of successful extensions: 18 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -