BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1282 (724 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76965.1 68414.m08961 glycine-rich protein 29 2.4 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 29 3.1 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 29 3.1 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 4.1 At2g19150.1 68415.m02235 pectinesterase family protein contains ... 29 4.1 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 5.5 At5g22390.1 68418.m02612 expressed protein 27 9.5 At2g25140.1 68415.m03007 heat shock protein 100, putative / HSP1... 27 9.5 At1g76110.1 68414.m08838 high mobility group (HMG1/2) family pro... 27 9.5 At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical... 27 9.5 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 396 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 301 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 29.1 bits (62), Expect = 3.1 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -2 Query: 462 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 286 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 29.1 bits (62), Expect = 3.1 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -2 Query: 462 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 286 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -2 Query: 183 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 49 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At2g19150.1 68415.m02235 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 339 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 153 ICGGVRILSADLENSGEGCTWRCRAGSYPYPQQV 254 I GG+ + ++ EGCT + R G YP P +V Sbjct: 185 ISGGIDFIFGGAQSIFEGCTLKLRVGIYP-PNEV 217 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 5.5 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 178 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 80 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 9.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 57 ERSGKSFLFCLSVRVPWNPIEG 122 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 >At2g25140.1 68415.m03007 heat shock protein 100, putative / HSP100, putative / heat shock protein clpB, putative / HSP100/ClpB, putative similar to HSP100/ClpB GI:9651530 [Phaseolus lunatus] Length = 964 Score = 27.5 bits (58), Expect = 9.5 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +1 Query: 178 LRTLKIQVRDVRGDVAPVRTHIRSRSQGEEPLVDRIM*VREVGKLDP*LRNKD 336 ++ LK ++DVRGD + S+ Q E + + + GKLDP + D Sbjct: 214 IQVLKDAIKDVRGDQRVTDRNPESKYQALEKYGNDLTEMARRGKLDPVIGRDD 266 >At1g76110.1 68414.m08838 high mobility group (HMG1/2) family protein / ARID/BRIGHT DNA-binding domain-containing protein low similarity to high mobility group protein [Plasmodium falciparum] GI:790198; contains Pfam profiles PF00505: HMG (high mobility group) box, PF01388: ARID/BRIGHT DNA binding domain Length = 338 Score = 27.5 bits (58), Expect = 9.5 Identities = 20/69 (28%), Positives = 26/69 (37%) Frame = -1 Query: 286 LFYRLEALHLGTCCGYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSRSEPYLPSIGF 107 L + E +HL T G P H +PS A TPP +R + P S F Sbjct: 120 LLFHYEQVHLFTARGPLLHPIATFHANPSTS-KEMALVEYTPPSIRYHNTHPPSQGSSSF 178 Query: 106 HGTRTLRQK 80 T+ K Sbjct: 179 TAIGTIEGK 187 >At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical to DNA Helicase [Arabidopsis thaliana] GI:11121449 Length = 1188 Score = 27.5 bits (58), Expect = 9.5 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 220 HLHVHPSPEFSRSAESIRTPPQMRCSSRSE 131 H H +P+ S S S+RTPP R +SR E Sbjct: 229 HYHSTSTPQPSVSNFSLRTPPVDRSASRLE 258 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,833,962 Number of Sequences: 28952 Number of extensions: 369853 Number of successful extensions: 1083 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1044 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1083 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1575119672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -