BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1280 (741 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 25 3.2 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 24 4.3 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 4.3 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 24 4.3 DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 24 5.7 Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein... 23 7.5 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 7.5 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 24.6 bits (51), Expect = 3.2 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -1 Query: 435 RIRFPSKPDTPRSSEPILIPKLRIQFADFPYL 340 R+R + TP+ +++PKL+ + A P+L Sbjct: 5 RLRLITSFGTPQDKRTMVLPKLKDETAVMPFL 36 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 387 LALRTGACRVWTGSGCGRCRVWSM 458 +++ G V G+ C C VWSM Sbjct: 5 ISVHVGQAGVQIGNPCWDCTVWSM 28 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -3 Query: 451 QTRHRPHPLPVQTRHAPVLRANPYSEVT 368 Q H PH Q +H P + P++ V+ Sbjct: 72 QLHHSPHQYHQQVQHQPQPPSTPFANVS 99 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 24.2 bits (50), Expect = 4.3 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -3 Query: 451 QTRHRPHPLPVQTRHAPVLRANPYSEVT 368 Q H PH Q +H P + P++ V+ Sbjct: 73 QLHHSPHQYHQQVQHQPQPPSTPFANVS 100 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 23.8 bits (49), Expect = 5.7 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 126 NSSRTSRRRLHATL 85 NSSRT+ RRL ATL Sbjct: 350 NSSRTAIRRLQATL 363 >Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein protein. Length = 192 Score = 23.4 bits (48), Expect = 7.5 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = -1 Query: 717 LDSRIPLVRASSELTVERRSYRIVPIAHETKPTRLTARKIRGRP 586 + + + L E V+ I+P A +KPT T + I +P Sbjct: 17 IGASVGLPTVDEENVVQAEQLPILPTADSSKPTDDTVKAIAPQP 60 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.4 bits (48), Expect = 7.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 674 PLNGGRTESCRSRTKRNR 621 P +GGR SCRS R R Sbjct: 262 PRSGGRWPSCRSPPARRR 279 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 825,083 Number of Sequences: 2352 Number of extensions: 17570 Number of successful extensions: 33 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -