BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1272 (768 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC14F5.09c |ade8||adenylosuccinate lyase Ade8|Schizosaccharomy... 136 4e-33 >SPBC14F5.09c |ade8||adenylosuccinate lyase Ade8|Schizosaccharomyces pombe|chr 2|||Manual Length = 482 Score = 136 bits (328), Expect = 4e-33 Identities = 91/179 (50%), Positives = 107/179 (59%), Gaps = 6/179 (3%) Frame = +3 Query: 9 QIGSSAMPYKRNPMRSER-CAL*PVI*LLYT*RS*YSCRPMVRTNPRRLCQSSHYPRRGF 185 QIGSSAM YKRNPMR ER C+ I L + V+ R L SS+ R Sbjct: 283 QIGSSAMAYKRNPMRCERICSQARYIMNLIPNALNTAS---VQWFERTLDDSSNR-RSLL 338 Query: 186 PY*RYSTDTI-KYLPR--PGGVSESDA--RHIAQELPFMATENIIMAMVQAGGDRQVCHE 350 P TD++ K L G V +HI ELPFMATENIIMAM + G R CHE Sbjct: 339 PEAFLFTDSVLKILLNVISGMVIYPKVIQKHIRAELPFMATENIIMAMTKHGASRHECHE 398 Query: 351 KIRVLSHEAGAQVKQHGRDNDLIERVKKDGYFAPIISQLDKILDASTFIGRAPNKWTSF 527 +IRVLSH+AG VK+ G DNDLIER+K YFAPI +LD +LDASTF+GRAP + SF Sbjct: 399 QIRVLSHQAGRVVKEEGGDNDLIERIKNTPYFAPIYDELDSLLDASTFVGRAPEQTESF 457 Score = 50.0 bits (114), Expect = 4e-07 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +1 Query: 100 NAANTHAVQWLERTLDDSANRR-IXXXXXXXXXXXXXXXXNICQGLVVYPKVMR 258 NA NT +VQW ERTLDDS+NRR + N+ G+V+YPKV++ Sbjct: 314 NALNTASVQWFERTLDDSSNRRSLLPEAFLFTDSVLKILLNVISGMVIYPKVIQ 367 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,912,499 Number of Sequences: 5004 Number of extensions: 55540 Number of successful extensions: 134 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 133 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 369323696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -