BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1272 (768 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 25 2.6 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 7.9 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 25.0 bits (52), Expect = 2.6 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +3 Query: 372 EAGAQVKQHGRDNDLIERVKKD-GYFAPIISQL 467 EA V QH R+ D E VK+D Y A ++ +L Sbjct: 473 EASRFVAQHVRNKDKFESVKEDWKYVALVLDRL 505 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 439 PSFLTRSIKSLSLPCC 392 P +TRS+ +L LP C Sbjct: 89 PELVTRSLSNLELPSC 104 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 729,083 Number of Sequences: 2352 Number of extensions: 13667 Number of successful extensions: 73 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -