BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1269 (615 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 29 0.041 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 2.7 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 4.7 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 21 6.2 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 8.2 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 28.7 bits (61), Expect = 0.041 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 609 VYLRLLEFLHVDIQSTGQKSHCVNTREGHRNAL 511 +YLR FL +D Q T + CVNT + L Sbjct: 326 IYLRTFGFLEIDDQGTVESFVCVNTLVSEQEGL 358 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 229 HRPHPLPVQTRHAPVLRANPYS 164 +R HPL + + H +L NP S Sbjct: 332 NRCHPLSLSSDHQAMLHHNPMS 353 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.8 bits (44), Expect = 4.7 Identities = 7/25 (28%), Positives = 12/25 (48%) Frame = -1 Query: 78 YGYEPARHLHVHPSPEFSRSAESIR 4 + Y P H +P+P + A+ R Sbjct: 76 WNYSPDNHFEQYPNPTYYNLADPAR 100 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.4 bits (43), Expect = 6.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 303 LYIFNMTLAKIVLRFGLDPDPRSP 374 L + + LA +V F DP R+P Sbjct: 444 LLVSKVALASVVKDFVFDPTERTP 467 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +2 Query: 20 DLENSGEGCTWRCRAGSYPYPQQVS 94 D N G+G + +C YP +S Sbjct: 613 DSINEGDGVSVQCTVSKGDYPLNIS 637 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,146 Number of Sequences: 336 Number of extensions: 3296 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15666150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -