BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1269 (615 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 3e-14 SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 3e-14 SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 6e-14 SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 74 1e-13 SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) 74 1e-13 SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) 74 1e-13 SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) 73 2e-13 SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 3e-13 SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 3e-13 SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 3e-13 SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 72 4e-13 SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 72 4e-13 SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 72 4e-13 SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 72 4e-13 SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 72 4e-13 SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 72 4e-13 SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 72 4e-13 SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 72 4e-13 SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 72 4e-13 SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 72 4e-13 SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) 72 4e-13 SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 72 4e-13 SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 4e-13 SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) 71 6e-13 SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 7e-13 SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 70 1e-12 SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 2e-12 SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 2e-12 SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 8e-10 SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 4e-08 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 48 6e-06 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 48 8e-06 SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) 42 4e-04 SB_48951| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_49552| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_21232| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40120| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_54855| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_27595| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_37312| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_18142| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_33090| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_21833| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_22731| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.060 SB_57449| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_20253| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_57686| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_4740| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_59705| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_59162| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_58689| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_58471| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_58275| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_57731| Best HMM Match : Vicilin_N (HMM E-Value=8.2) 33 0.14 SB_57504| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_57309| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_57160| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_57088| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_57000| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_56985| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_56864| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_56097| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_55911| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_55353| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_54657| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_54057| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_53941| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_53667| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_53456| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_53282| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_53229| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_52843| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_51637| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_51120| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_51074| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_51032| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_51007| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_50996| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_50982| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_50953| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_50936| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_50384| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_50220| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_49746| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_49667| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_49638| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_49334| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_49116| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_49113| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_49028| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_48983| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_48970| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_48539| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_48364| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_47957| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_47808| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_47799| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_47505| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_47385| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_47361| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_47000| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_46654| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_46429| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_46359| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_46213| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_45478| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_45234| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_44852| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_44662| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_43993| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_43758| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_43593| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_43340| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_43144| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_43093| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_42443| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_42383| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_42278| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_42126| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_41977| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_40549| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_40449| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_40443| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_40197| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_39975| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_39947| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_39754| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_39490| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_38568| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_38390| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_38374| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_38338| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_38296| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_37924| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_37621| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_37575| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_37514| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_36927| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_36336| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_36111| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_35639| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_35629| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_35549| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_35413| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_35273| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_35215| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_35079| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_34965| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_34867| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_34812| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_34787| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_34475| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_34273| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_34020| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_34019| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_33968| Best HMM Match : Transformer (HMM E-Value=5.1) 33 0.14 SB_33900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_33769| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_33633| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_33363| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_33156| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_33065| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_32699| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_32249| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_31827| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_31689| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_31560| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_31456| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_31442| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_31298| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_31283| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_31155| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_31061| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_30878| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_29626| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_29443| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_28945| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_28854| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_28678| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_28435| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_27859| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_27744| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_27513| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_27344| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_26541| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_26180| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_26102| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_26045| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_25987| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_25886| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_24955| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_24149| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_24008| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_23901| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_23701| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_23491| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_23324| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_23308| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_23301| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_23277| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_22929| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_22744| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_22512| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_22481| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_22451| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_21947| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_21159| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_21030| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_20944| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_20880| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_20832| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_20742| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_20690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_20420| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_20060| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_20036| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_19743| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_19490| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_19448| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_19196| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_18813| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_18603| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_18478| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_18315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_17938| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_17616| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_17417| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_17352| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_17230| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_16690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_16230| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_15921| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_15429| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_15370| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_14040| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_13500| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_12864| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_12842| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_12053| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_12049| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_11704| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_11587| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) 33 0.14 SB_10981| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_10838| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_10043| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_9790| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_9789| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_9564| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_9236| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_9227| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_9169| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_8778| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_8203| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_8131| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_7699| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_7316| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_7204| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_6994| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_6265| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_6232| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_6109| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_6103| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_5995| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_5987| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_5937| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_5666| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_5533| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_4915| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_4853| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_4538| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_4213| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_4133| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_3630| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_3555| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_3396| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_3272| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_3008| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_2936| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_2741| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_2242| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_1859| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_1767| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_1708| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_1630| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_1626| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_1413| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_1202| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 >SB_29170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 75.4 bits (177), Expect = 3e-14 Identities = 36/60 (60%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R P+ EF + S R+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTRKSMSSPNIEFLQPGGSTRS 98 >SB_29105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 75.4 bits (177), Expect = 3e-14 Identities = 38/57 (66%), Positives = 40/57 (70%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 10 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R PEFSR ES Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSFPEFSRVVES 93 >SB_40798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 74.9 bits (176), Expect = 5e-14 Identities = 38/63 (60%), Positives = 43/63 (68%) Frame = -1 Query: 189 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 10 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRA 93 Query: 9 IRT 1 RT Sbjct: 94 HRT 96 >SB_44784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 74.5 bits (175), Expect = 6e-14 Identities = 37/60 (61%), Positives = 42/60 (70%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP+F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPDFQGSSRAHRT 96 >SB_29439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 74.1 bits (174), Expect = 8e-14 Identities = 37/60 (61%), Positives = 42/60 (70%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP FS ++ + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFSGASRAHRT 85 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 74.1 bits (174), Expect = 8e-14 Identities = 38/67 (56%), Positives = 43/67 (64%) Frame = -1 Query: 201 PDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSR 22 P + EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F Sbjct: 84 PRQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQG 141 Query: 21 SAESIRT 1 S+ + RT Sbjct: 142 SSRAHRT 148 >SB_52358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_48779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_46560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_44599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 97 >SB_41858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_39045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 73.7 bits (173), Expect = 1e-13 Identities = 40/80 (50%), Positives = 47/80 (58%), Gaps = 1/80 (1%) Frame = -1 Query: 237 RPGTGRIRFPS-KPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPA 61 RP GR+ + + EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ Sbjct: 20 RPAPGRVHWLQVSARQTQPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRT 79 Query: 60 RHLHVHPSPEFSRSAESIRT 1 R SP F + + RT Sbjct: 80 R--KSMSSPNFQGPSRAHRT 97 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_30495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_24853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_15774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_15546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_6174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 97 >SB_1857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_58644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_58116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_55314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_54229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_53524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_53359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 85 >SB_49581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_46357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_41634| Best HMM Match : DUF1518 (HMM E-Value=5.9) Length = 321 Score = 73.7 bits (173), Expect = 1e-13 Identities = 40/77 (51%), Positives = 46/77 (59%) Frame = -1 Query: 231 GTGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHL 52 G G + P P + EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 238 GPGPLASSLSPTDP-TLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR-- 294 Query: 51 HVHPSPEFSRSAESIRT 1 SP F + + RT Sbjct: 295 KSMSSPNFQGPSRAHRT 311 >SB_39956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 85 >SB_37493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 85 >SB_29382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_26769| Best HMM Match : Popeye (HMM E-Value=1.8) Length = 411 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 191 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 248 >SB_13902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_6814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_4334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 85 >SB_2347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_2215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 73.7 bits (173), Expect = 1e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRAHRT 96 >SB_7830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 72.9 bits (171), Expect = 2e-13 Identities = 37/63 (58%), Positives = 42/63 (66%) Frame = -1 Query: 189 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 10 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRA 93 Query: 9 IRT 1 RT Sbjct: 94 HRT 96 >SB_55687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 72.9 bits (171), Expect = 2e-13 Identities = 37/63 (58%), Positives = 42/63 (66%) Frame = -1 Query: 189 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 10 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRA 93 Query: 9 IRT 1 RT Sbjct: 94 HRT 96 >SB_44808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 72.9 bits (171), Expect = 2e-13 Identities = 37/63 (58%), Positives = 42/63 (66%) Frame = -1 Query: 189 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 10 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRA 93 Query: 9 IRT 1 RT Sbjct: 94 HRT 96 >SB_12205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 72.9 bits (171), Expect = 2e-13 Identities = 37/63 (58%), Positives = 42/63 (66%) Frame = -1 Query: 189 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 10 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRA 93 Query: 9 IRT 1 RT Sbjct: 94 HRT 96 >SB_10006| Best HMM Match : 7tm_1 (HMM E-Value=0.0022) Length = 309 Score = 72.9 bits (171), Expect = 2e-13 Identities = 37/63 (58%), Positives = 42/63 (66%) Frame = -1 Query: 189 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 10 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRA 93 Query: 9 IRT 1 RT Sbjct: 94 HRT 96 >SB_7277| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 72.9 bits (171), Expect = 2e-13 Identities = 37/63 (58%), Positives = 42/63 (66%) Frame = -1 Query: 189 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 10 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRA 93 Query: 9 IRT 1 RT Sbjct: 94 HRT 96 >SB_1811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 72.9 bits (171), Expect = 2e-13 Identities = 37/63 (58%), Positives = 42/63 (66%) Frame = -1 Query: 189 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 10 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRA 93 Query: 9 IRT 1 RT Sbjct: 94 HRT 96 >SB_27272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 72.5 bits (170), Expect = 2e-13 Identities = 36/60 (60%), Positives = 41/60 (68%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL+PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILLPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_26100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 72.5 bits (170), Expect = 2e-13 Identities = 43/86 (50%), Positives = 48/86 (55%) Frame = -1 Query: 258 TYARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCG 79 T R S PG S T + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 21 TPGRASASPGRVHWLQVSARQT-QPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG 79 Query: 78 YGYEPARHLHVHPSPEFSRSAESIRT 1 Y Y+ R SP F + + RT Sbjct: 80 YEYDRTR--KSMSSPNFQGPSRAHRT 103 >SB_58070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 72.5 bits (170), Expect = 2e-13 Identities = 43/86 (50%), Positives = 48/86 (55%) Frame = -1 Query: 258 TYARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCG 79 T R S PG S T + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 86 TPGRASASPGRVHWLQVSARQT-QPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG 144 Query: 78 YGYEPARHLHVHPSPEFSRSAESIRT 1 Y Y+ R SP F + + RT Sbjct: 145 YEYDRTR--KSMSSPNFQGPSRAHRT 168 >SB_50881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 72.5 bits (170), Expect = 2e-13 Identities = 43/86 (50%), Positives = 48/86 (55%) Frame = -1 Query: 258 TYARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCG 79 T R S PG S T + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 15 TPGRASASPGRVHWLQVSARQT-QPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG 73 Query: 78 YGYEPARHLHVHPSPEFSRSAESIRT 1 Y Y+ R SP F + + RT Sbjct: 74 YEYDRTR--KSMSSPNFQGPSRAHRT 97 >SB_44160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 72.5 bits (170), Expect = 2e-13 Identities = 43/86 (50%), Positives = 48/86 (55%) Frame = -1 Query: 258 TYARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCG 79 T R S PG S T + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 35 TPGRASASPGRVHWLQVSARQT-QPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG 93 Query: 78 YGYEPARHLHVHPSPEFSRSAESIRT 1 Y Y+ R SP F + + RT Sbjct: 94 YEYDRTR--KSMSSPNFQGPSRAHRT 117 >SB_37446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 72.5 bits (170), Expect = 2e-13 Identities = 43/86 (50%), Positives = 48/86 (55%) Frame = -1 Query: 258 TYARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCG 79 T R S PG S T + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 21 TPGRASASPGRVHWLQVSARQT-QPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG 79 Query: 78 YGYEPARHLHVHPSPEFSRSAESIRT 1 Y Y+ R SP F + + RT Sbjct: 80 YEYDRTR--KSMSSPNFQGPSRAHRT 103 >SB_12263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 72.5 bits (170), Expect = 2e-13 Identities = 43/86 (50%), Positives = 48/86 (55%) Frame = -1 Query: 258 TYARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCG 79 T R S PG S T + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 3 TPGRASASPGRVHWLQVSARQT-QPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG 61 Query: 78 YGYEPARHLHVHPSPEFSRSAESIRT 1 Y Y+ R SP F + + RT Sbjct: 62 YEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_5558| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 72.5 bits (170), Expect = 2e-13 Identities = 37/60 (61%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F S+ RT Sbjct: 78 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGSSRVHRT 135 >SB_42078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 72.1 bits (169), Expect = 3e-13 Identities = 43/87 (49%), Positives = 48/87 (55%) Frame = -1 Query: 261 RTYARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCC 82 R R S PG S T + EPIL PKLRI FADFPYLH SI+ RL TLETCC Sbjct: 14 RPPGRASASPGRVHWLQVSARQT-QPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCC 72 Query: 81 GYGYEPARHLHVHPSPEFSRSAESIRT 1 GY Y+ R SP F + + RT Sbjct: 73 GYEYDRTR--KSMSSPNFQGPSRAHRT 97 >SB_35268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 72.1 bits (169), Expect = 3e-13 Identities = 43/86 (50%), Positives = 48/86 (55%) Frame = -1 Query: 258 TYARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCG 79 T R S PG S T + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 15 TPERASASPGRVHWLQVSARQT-QPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG 73 Query: 78 YGYEPARHLHVHPSPEFSRSAESIRT 1 Y Y+ R SP F + + RT Sbjct: 74 YEYDRTR--KSMSSPNFQGPSRAHRT 97 >SB_3778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 72.1 bits (169), Expect = 3e-13 Identities = 43/86 (50%), Positives = 48/86 (55%) Frame = -1 Query: 258 TYARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCG 79 T R S PG S T + EPIL PKLRI FADFPYLH SI+ RL TLETCCG Sbjct: 3 TPERASASPGRVHWLQVSARQT-QPLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCG 61 Query: 78 YGYEPARHLHVHPSPEFSRSAESIRT 1 Y Y+ R SP F + + RT Sbjct: 62 YEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_59787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_59379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_59234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_58491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_57948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_56753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_55151| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 402 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 178 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 235 >SB_53500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 134 >SB_53114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_52245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_51644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_51062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_48392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_48030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 134 >SB_46317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_46148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_46056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_46043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_46002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_44153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_44091| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 169 >SB_44051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_43906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_42917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_41356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_41249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_40472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_39541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_39402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 34 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 91 >SB_39300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_38833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_37911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_37424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_37302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_37110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 169 >SB_34334| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 169 >SB_33667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_33364| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_31814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_30660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_30006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_29366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_27748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_27084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_27021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_26273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_26010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_25677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_25546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 97 >SB_24341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_23921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_19588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_19288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_18833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_18210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_18149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 40 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 97 >SB_17336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_16953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_15920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 181 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 238 >SB_15538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_14422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_13971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_12408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_12224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_11305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_11121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 49 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 106 >SB_7698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 134 >SB_6536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 134 >SB_4627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_4362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_527| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 218 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 151 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 208 >SB_59314| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 169 >SB_58870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_58253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_57993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_54803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_53700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_53306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_53021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_52780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_51768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_51582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_51426| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 179 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 112 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 169 >SB_50985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_50975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_49521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_49109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_47871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_45833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_45139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_44724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_42353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_42008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_41961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_41530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_41130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_40711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_40110| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 150 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 207 >SB_39752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_39077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_37191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_36226| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_34914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_34567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_34080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_33471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_31864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_29675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_28321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_27775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_27330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_26901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_26760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_26472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_26164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_25733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_24943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_23689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_22336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_22065| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 217 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 150 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 207 >SB_21160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_20762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_19810| Best HMM Match : Cathelicidins (HMM E-Value=4.8) Length = 204 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 137 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 194 >SB_19474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_19236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_19110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_19089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 134 >SB_18734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_18260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_17829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_17440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_16931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_14957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_14500| Best HMM Match : Vicilin_N (HMM E-Value=5.3) Length = 237 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_14440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_14017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_11334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_10849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_6271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_5929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_5657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_5275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_4697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_4589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_4504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 78 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 135 >SB_4388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 77 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 134 >SB_3842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 28 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 85 >SB_3072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_2183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_2030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_1600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_1514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.7 bits (168), Expect = 4e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_15901| Best HMM Match : Defensin_1 (HMM E-Value=8.6) Length = 106 Score = 71.3 bits (167), Expect = 6e-13 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLHTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_16989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 71.3 bits (167), Expect = 6e-13 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = -1 Query: 189 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPAR 58 +S EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 36 QSLEPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR 79 >SB_16792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 71.3 bits (167), Expect = 6e-13 Identities = 37/75 (49%), Positives = 45/75 (60%) Frame = -1 Query: 225 GRIRFPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHV 46 GR+ + + +PIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 23 GRVHWLQVSARQTNLKPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KS 80 Query: 45 HPSPEFSRSAESIRT 1 SP F + + RT Sbjct: 81 MSSPNFQGPSRAHRT 95 >SB_11405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 70.9 bits (166), Expect = 7e-13 Identities = 36/60 (60%), Positives = 39/60 (65%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYNRTR--KSMSSPNFQGPSRAHRT 96 >SB_25780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 70.5 bits (165), Expect = 1e-12 Identities = 36/63 (57%), Positives = 41/63 (65%) Frame = -1 Query: 189 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 10 +S EPIL KLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSKEPILFSKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRA 93 Query: 9 IRT 1 RT Sbjct: 94 HRT 96 >SB_17175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 70.5 bits (165), Expect = 1e-12 Identities = 35/60 (58%), Positives = 39/60 (65%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F ++ T Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGRQDATET 96 >SB_2991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 70.5 bits (165), Expect = 1e-12 Identities = 35/60 (58%), Positives = 40/60 (66%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH +I+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 52 EPILFPKLRIYFADFPYLHCAINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 109 >SB_48541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPAR 58 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR 79 >SB_12204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPAR 58 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR 79 >SB_5999| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 70.1 bits (164), Expect = 1e-12 Identities = 35/60 (58%), Positives = 39/60 (65%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI F DFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFVDFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_5290| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -1 Query: 189 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPAR 58 +S +PIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 36 QSLDPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR 79 >SB_55223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPAR 58 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR 79 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPAR 58 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ R Sbjct: 734 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR 774 >SB_29399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 69.7 bits (163), Expect = 2e-12 Identities = 36/63 (57%), Positives = 41/63 (65%) Frame = -1 Query: 189 RSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 10 +S EPIL KLRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + Sbjct: 36 QSLEPILFSKLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRA 93 Query: 9 IRT 1 RT Sbjct: 94 HRT 96 >SB_57544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 69.3 bits (162), Expect = 2e-12 Identities = 35/60 (58%), Positives = 39/60 (65%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 EPIL PKLRI FADFPYLH SI+ RL LETCCGY Y+ R SP F + + RT Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLKLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 96 >SB_8963| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 69.3 bits (162), Expect = 2e-12 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 190 PVLRANPYSEVTDPICRLPLPTLFYRLEALHLGDLLRIWVR 68 P LRANP+ EVTD CRLPLPTLFY+ EA HLGDLLR+ VR Sbjct: 77 PTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGDLLRLLVR 117 >SB_25347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 68.9 bits (161), Expect = 3e-12 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYE 67 EPIL PKLRI FADFPYLH SI+ RL TLETCCGY Y+ Sbjct: 39 EPILFPKLRIYFADFPYLHCSINQRLLTLETCCGYEYD 76 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 65.7 bits (153), Expect = 3e-11 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 190 PVLRANPYSEVTDPICRLPLPTLFYRLEALHLGDLLR 80 P LRANP+ EVTD CRLPLPTLFY+ EA HLGDLLR Sbjct: 37 PTLRANPFPEVTDLFCRLPLPTLFYQPEAAHLGDLLR 73 >SB_38201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 60.9 bits (141), Expect = 8e-10 Identities = 33/71 (46%), Positives = 41/71 (57%) Frame = -1 Query: 213 FPSKPDTPRSSEPILIPKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSP 34 F ++ P + P +LRI FADFPYLH SI+ RL TLETCCGY Y+ R SP Sbjct: 1 FSARQTQPLEANPFS-RRLRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSP 57 Query: 33 EFSRSAESIRT 1 F + + RT Sbjct: 58 NFQGPSRAHRT 68 >SB_34291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 60.1 bits (139), Expect = 1e-09 Identities = 30/50 (60%), Positives = 33/50 (66%) Frame = -1 Query: 159 LRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 10 LRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + ES Sbjct: 1 LRIYFADFPYLHVSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGAVES 48 >SB_37577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 58.8 bits (136), Expect = 3e-09 Identities = 30/53 (56%), Positives = 34/53 (64%) Frame = -1 Query: 159 LRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 LRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 51 >SB_9828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 58.8 bits (136), Expect = 3e-09 Identities = 30/53 (56%), Positives = 34/53 (64%) Frame = -1 Query: 159 LRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 LRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 51 >SB_54766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 58.8 bits (136), Expect = 3e-09 Identities = 30/53 (56%), Positives = 34/53 (64%) Frame = -1 Query: 159 LRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 LRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 2 LRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 52 >SB_46053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 58.8 bits (136), Expect = 3e-09 Identities = 30/53 (56%), Positives = 34/53 (64%) Frame = -1 Query: 159 LRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 LRI FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 1 LRIYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 51 >SB_15129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 55.6 bits (128), Expect = 3e-08 Identities = 28/51 (54%), Positives = 32/51 (62%) Frame = -1 Query: 153 IQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 I FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 4 IYFADFPYLHVSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 52 >SB_5943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 55.2 bits (127), Expect = 4e-08 Identities = 28/51 (54%), Positives = 32/51 (62%) Frame = -1 Query: 153 IQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 I FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 10 IYFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 58 >SB_1430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 55.2 bits (127), Expect = 4e-08 Identities = 28/55 (50%), Positives = 34/55 (61%) Frame = -1 Query: 165 PKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 P++ FADFPYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 45 PEVTDLFADFPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 97 >SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) Length = 276 Score = 48.0 bits (109), Expect = 6e-06 Identities = 25/55 (45%), Positives = 31/55 (56%) Frame = -1 Query: 165 PKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 P++ F PYLH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 149 PEVTDLFCRLPYLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 201 Score = 35.1 bits (77), Expect = 0.046 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 190 PVLRANPYSEVTDPICRLP 134 P LRANP+ EVTD CRLP Sbjct: 141 PTLRANPFPEVTDLFCRLP 159 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 47.6 bits (108), Expect = 8e-06 Identities = 24/35 (68%), Positives = 26/35 (74%), Gaps = 2/35 (5%) Frame = -1 Query: 180 EPILIPKLRIQFADFPYLHYSID*RLF--TLETCC 82 EPIL PKLRI FADFPYLH SI+ RL LE+ C Sbjct: 52 EPILFPKLRIYFADFPYLHCSINQRLLGDPLESTC 86 >SB_44744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 44.8 bits (101), Expect = 6e-05 Identities = 24/55 (43%), Positives = 30/55 (54%) Frame = -1 Query: 165 PKLRIQFADFPYLHYSID*RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 P++ F P LH SI+ RL TLETCCGY Y+ R SP F + + RT Sbjct: 45 PEVTDLFCRLPLLHCSINQRLLTLETCCGYEYDRTR--KSMSSPNFQGPSRAHRT 97 Score = 36.7 bits (81), Expect = 0.015 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 190 PVLRANPYSEVTDPICRLPL 131 P LRANP+ EVTD CRLPL Sbjct: 37 PTLRANPFPEVTDLFCRLPL 56 >SB_42131| Best HMM Match : 7tm_1 (HMM E-Value=8.5e-35) Length = 521 Score = 41.9 bits (94), Expect = 4e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -3 Query: 574 HSEHWAEITLRQHPRGPSQCFV 509 ++EHWAEITLRQH PSQCFV Sbjct: 48 NNEHWAEITLRQHRFRPSQCFV 69 >SB_48951| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/33 (60%), Positives = 22/33 (66%) Frame = -1 Query: 108 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 10 RL TLETCCGY Y+ R SPEFSR+ ES Sbjct: 1 RLLTLETCCGYEYDRTR--KSMSSPEFSRAVES 31 >SB_49552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 38.3 bits (85), Expect = 0.005 Identities = 19/33 (57%), Positives = 21/33 (63%) Frame = -1 Query: 108 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 10 RL TLETCCGY Y+ R PEFSR+ ES Sbjct: 1 RLLTLETCCGYEYDRTR--KSMSFPEFSRAVES 31 >SB_21232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 39 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = -1 Query: 108 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 10 RL TLETCCGY Y+ R ++ PEFS + ES Sbjct: 1 RLLTLETCCGYEYD--RDTKINVFPEFSGAVES 31 >SB_40120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/33 (57%), Positives = 21/33 (63%) Frame = -1 Query: 108 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 10 RL TLETCCGY Y+ R SPEFS + ES Sbjct: 1 RLLTLETCCGYEYDRTR--KSMSSPEFSGAVES 31 >SB_54855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 39 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/36 (50%), Positives = 23/36 (63%) Frame = -1 Query: 108 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAESIRT 1 RL TLETCCGY Y+ R + SP+FS + + RT Sbjct: 1 RLLTLETCCGYEYDRTR--KIMSSPKFSGPSRAHRT 34 >SB_27595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 36.7 bits (81), Expect = 0.015 Identities = 18/33 (54%), Positives = 20/33 (60%) Frame = -1 Query: 108 RLFTLETCCGYGYEPARHLHVHPSPEFSRSAES 10 RL TLETCCGY Y+ R SP F R+ ES Sbjct: 1 RLLTLETCCGYEYDRTR--KSMSSPNFPRAVES 31 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 36.7 bits (81), Expect = 0.015 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +1 Query: 559 PSALNVNVKKFKQAQVNGG 615 PSALNV VKKF QA+VNGG Sbjct: 31 PSALNVKVKKFNQARVNGG 49 >SB_37312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 35.9 bits (79), Expect = 0.026 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -1 Query: 108 RLFTLETCCGYGYEPARHLHVHPSPEFSR 22 RL LETCCGY Y+ R ++V PEFS+ Sbjct: 1 RLLPLETCCGYEYDRTRKINVF--PEFSK 27 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,497,696 Number of Sequences: 59808 Number of extensions: 443739 Number of successful extensions: 2005 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1890 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1997 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1512078125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -