BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm1267 (541 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 22 3.5 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 22 3.5 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 8.1 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 8.1 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 8.1 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.2 bits (45), Expect = 3.5 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 247 KRRSDSCQYCR 279 KR+ + CQYCR Sbjct: 156 KRQRNRCQYCR 166 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.2 bits (45), Expect = 3.5 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 247 KRRSDSCQYCR 279 KR+ + CQYCR Sbjct: 156 KRQRNRCQYCR 166 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.0 bits (42), Expect = 8.1 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 172 VSLRFTGMYRRRDSSISRHYNTR 240 + LR Y + S +SRHY+TR Sbjct: 286 LDLRSQLEYDLQTSIMSRHYSTR 308 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.0 bits (42), Expect = 8.1 Identities = 10/50 (20%), Positives = 20/50 (40%) Frame = +1 Query: 187 TGMYRRRDSSISRHYNTRRCKRRSDSCQYCRRHTTSCRAGGGFDYNTSSA 336 T Y + + +H T K + + + H +C+ + TSS+ Sbjct: 369 TSTYSGSPTELPKHLPTSLTKSKMEVMELSDLHHPNCKINRKVHHTTSSS 418 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.0 bits (42), Expect = 8.1 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 320 ITRQARRLYVGNIPFGVTEEETMEFFN 400 ITR L V P TE E FF+ Sbjct: 482 ITRDISSLVVQEQPTPTTESEERRFFS 508 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,561 Number of Sequences: 438 Number of extensions: 3799 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15336375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -